Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA23475_WB12.jpg WB (Western Blot) (WB Suggested Anti-GRSF1 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateGRSF1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Rabbit GRSF1 Polyclonal Antibody | anti-GRSF1 antibody

GRSF1 antibody - middle region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GRSF1, Antibody; GRSF1 antibody - middle region; anti-GRSF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV
Sequence Length
480
Applicable Applications for anti-GRSF1 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GRSF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-GRSF1 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateGRSF1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

product-image-AAA23475_WB12.jpg WB (Western Blot) (WB Suggested Anti-GRSF1 Antibody Titration: 0.2-1 ug/mlPositive Control: Hela cell lysateGRSF1 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

WB (Western Blot)

(Host: RabbitTarget Name: GRSF1Sample Type: JurkatAntibody Dilution: 1.0ug/mlGRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA23475_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: GRSF1Sample Type: JurkatAntibody Dilution: 1.0ug/mlGRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: GRSF1Sample Type: JurkatAntibody Dilution: 1.0ug/mlGRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA23475_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: GRSF1Sample Type: JurkatAntibody Dilution: 1.0ug/mlGRSF1 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: GRSF1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA23475_WB9.jpg WB (Western Blot) (Host: RabbitTarget Name: GRSF1Sample Type: Human Fetal LungAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GRSF1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23475_WB8.jpg WB (Western Blot) (Host: RabbitTarget Name: GRSF1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GRSF1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

product-image-AAA23475_WB7.jpg WB (Western Blot) (Host: RabbitTarget Name: GRSF1Sample Type: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GRSF1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

product-image-AAA23475_WB6.jpg WB (Western Blot) (Host: RabbitTarget Name: GRSF1Sample Type: Human Fetal HeartAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GRSF1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA23475_WB5.jpg WB (Western Blot) (Host: RabbitTarget Name: GRSF1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GRSF1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

product-image-AAA23475_WB4.jpg WB (Western Blot) (Host: RabbitTarget Name: GRSF1Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GRSF1Sample Type: HelaAntibody Dilution: 1.0ug/ml)

product-image-AAA23475_WB3.jpg WB (Western Blot) (Host: RabbitTarget Name: GRSF1Sample Type: HelaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GRSF1Sample Type: HelaAntibody Dilution: 1.0ug/ml)

product-image-AAA23475_WB2.jpg WB (Western Blot) (Host: RabbitTarget Name: GRSF1Sample Type: HelaAntibody Dilution: 1.0ug/ml)

WB (Western Blot)

(Host: RabbitTarget Name: GRSF1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)

product-image-AAA23475_WB.jpg WB (Western Blot) (Host: RabbitTarget Name: GRSF1Sample Tissue: Human 293TAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GRSF1 antibody
This is a rabbit polyclonal antibody against GRSF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GRSF1 is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm.The protein encoded by this gene is a cellular protein that binds RNAs containing the G-rich element. Using indirect immunofluorescence microscopy this protein was found to be localized in the cytoplasm. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.The protein encoded by this gene is a cellular protein that binds RNAs containing the G-rich element. The protein is localized in the cytoplasm, and has been shown to stimulate translation of viral mRNAs in vitro. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-GRSF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
G-rich sequence factor 1 isoform 1
NCBI Official Synonym Full Names
G-rich RNA sequence binding factor 1
NCBI Official Symbol
GRSF1
NCBI Protein Information
G-rich sequence factor 1
UniProt Protein Name
G-rich sequence factor 1
UniProt Gene Name
GRSF1
UniProt Synonym Gene Names
GRSF-1
UniProt Entry Name
GRSF1_HUMAN

Similar Products

Product Notes

The GRSF1 grsf1 (Catalog #AAA23475) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRSF1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GRSF1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the GRSF1 grsf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IRNGENGIHF LLNRDGKRRG DALIEMESEQ DVQKALEKHR MYMGQRYVEV. It is sometimes possible for the material contained within the vial of "GRSF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.