Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GRPRSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human GRPR Polyclonal Antibody | anti-GRPR antibody

GRPR Antibody - N-terminal region

Gene Names
GRPR; BB2; BB2R
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GRPR; Polyclonal Antibody; GRPR Antibody - N-terminal region; anti-GRPR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLI
Sequence Length
384
Applicable Applications for anti-GRPR antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GRPR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GRPRSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GRPRSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GRPR antibody
This is a rabbit polyclonal antibody against GRPR. It was validated on Western Blot

Target Description: Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for neoplastic tissues. The effects of GRP are mediated through the gastrin-releasing peptide receptor. This receptor is a glycosylated, 7-transmembrane G-protein coupled receptor that activates the phospholipase C signaling pathway. The receptor is aberrantly expressed in numerous cancers such as those of the lung, colon, and prostate. An individual with autism and multiple exostoses was found to have a balanced translocation between chromosome 8 and a chromosome X breakpoint located within the gastrin-releasing peptide receptor gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
gastrin-releasing peptide receptor
NCBI Official Synonym Full Names
gastrin releasing peptide receptor
NCBI Official Symbol
GRPR
NCBI Official Synonym Symbols
BB2; BB2R
NCBI Protein Information
gastrin-releasing peptide receptor
UniProt Protein Name
Gastrin-releasing peptide receptor
UniProt Gene Name
GRPR
UniProt Synonym Gene Names
GRP-R
UniProt Entry Name
GRPR_HUMAN

NCBI Description

Gastrin-releasing peptide (GRP) regulates numerous functions of the gastrointestinal and central nervous systems, including release of gastrointestinal hormones, smooth muscle cell contraction, and epithelial cell proliferation and is a potent mitogen for neoplastic tissues. The effects of GRP are mediated through the gastrin-releasing peptide receptor. This receptor is a glycosylated, 7-transmembrane G-protein coupled receptor that activates the phospholipase C signaling pathway. The receptor is aberrantly expressed in numerous cancers such as those of the lung, colon, and prostate. An individual with autism and multiple exostoses was found to have a balanced translocation between chromosome 8 and a chromosome X breakpoint located within the gastrin-releasing peptide receptor gene. [provided by RefSeq, Jul 2008]

Uniprot Description

GRPR: Receptor for gastrin releasing peptide (GRP). This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xp22.2

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: bombesin receptor activity; peptide receptor activity, G-protein coupled

Biological Process: G-protein coupled receptor protein signaling pathway; cell proliferation; bombesin receptor signaling pathway; regulation of cell proliferation

Research Articles on GRPR

Similar Products

Product Notes

The GRPR grpr (Catalog #AAA3220283) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRPR Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GRPR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GRPR grpr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FLLNLEVDHF MHCNISSHSA DLPVNDDWSH PGILYVIPAV YGVIILIGLI. It is sometimes possible for the material contained within the vial of "GRPR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.