Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '12838'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
2.73 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '12838' and pd.language_id = 1
Query
Database
2.42 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '12838'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
2.12 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '12838'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '12838' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '12838'
⇄products_name => string (28) "Clara Cell Protein 16 (CC16)"
$value['products_name']
⇄products_name_oem => string (42) "Rat Clara Cell Protein 16 (CC16) ELISA Kit"
$value['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value['products_name_syn']
⇄products_gene_name => string (4) "CC16"
$value['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value['products_gene_name_syn']
⇄⧉products_description => string (673) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is Rat CC16 monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄products_name => string (28) "Clara Cell Protein 16 (CC16)"
$value->a['products_name']
⇄products_name_oem => string (42) "Rat Clara Cell Protein 16 (CC16) ELISA Kit"
$value->a['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value->a['products_name_syn']
⇄products_gene_name => string (4) "CC16"
$value->a['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value->a['products_gene_name_syn']
⇄⧉products_description => string (673) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value->a['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is Rat CC16 monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄products_name => string (28) "Clara Cell Protein 16 (CC16)"
$value->d['products_name']
⇄products_name_oem => string (42) "Rat Clara Cell Protein 16 (CC16) ELISA Kit"
$value->d['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value->d['products_name_syn']
⇄products_gene_name => string (4) "CC16"
$value->d['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value->d['products_gene_name_syn']
⇄⧉products_description => string (673) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value->d['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is Rat CC16 monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄⧉specificity => string (186) "The Human CD115 ELISA Kit allows for the detection and quantification of end...
$value[0]['_source']['specificity']
The Human CD115 ELISA Kit allows for the detection and quantification of endogenous levels of natural and/or recombinant Human CD115 proteins within the range of 62.5 pg/ml - 4000 pg/ml.
⇄purity => string (3) "N/A"
$value[0]['_source']['purity']
⇄form => string (3) "N/A"
$value[0]['_source']['form']
⇄concentration => string (3) "N/A"
$value[0]['_source']['concentration']
⇄⧉storage_stability => string (107) "Shipped and store at 4 degree C for 6 months, store at -20 degree C for one ...
$value[0]['_source']['storage_stability']
Shipped and store at 4 degree C for 6 months, store at -20 degree C for one year. Avoid freeze/thaw cycles.
⇄⧉products_description => string (1656) "Principle of the Assay: The Human CD115 ELISA (Enzyme-Linked Immunosorbent A...
$value[0]['_source']['products_description']
Principle of the Assay: The Human CD115 ELISA (Enzyme-Linked Immunosorbent Assay) kit is an in vitro enzyme-linked immunosorbent assay for the quantitative measurement of Human CD115 in Cell Culture Supernatants, Serum, Plasma. This assay employs an antibody specific for Human CD115 coated on a 96-well plate. Standards and samples are pipetted into the wells and CD115 present in a sample is bound to the wells by the immobilized antibody. The wells are washed and biotinylated anti-Human CD115 antibody is added. After washing away unbound biotinylated antibody, HRP-conjugated streptavidin is pipetted to the wells. The wells are again washed, a TMB substrate solution is added to the wells and color develops in proportion to the amount of CD115 bound. The Stop Solution changes the color from blue to yellow, and the intensity of the color is measured at 450 nm.<br><br>Background/Introduction: CSF1R (Colony stimulating factor 1 receptor),also known as M-CSFR and CD115, is a cell-surface protein encoded, in humans, by the CSF1R gene. The gene is located on long arm of chromosome 5 (5q32) on the Crick (minus) strand. The encoded protein is a tyrosine kinase transmembrane receptor and member of the CSF1/PDGF receptor family of tyrosine-protein kinases. The encoded protein is a single pass type I membrane protein and acts as the receptor for colony stimulating factor 1, a cytokine which controls the production, differentiation, and function of macrophages. Both CSF1R, and its ligand colony stimulating factor 1 play an important role in the development of the mammary gland and may be involved in the process of mammary gland carcinogenesis.
⇄⧉search_terms => string (598) "aaa17901 human the cd115 elisa kit allows for detection and quantification o...
$value[0]['_source']['search_terms']
aaa17901 human the cd115 elisa kit allows for detection and quantification of endogenous levels natural or recombinant proteins within range 62.5 pg ml 4000 sandwich se typical testing data standard curve reference only aaa17901_sc fms macrophage colony stimulating factor 1 receptor csf r 1r m proto oncogene c csf1r csfr fim2 hdls antigen i mcdonough feline sarcoma viral v homolog 33,248 da ec:2.7.10.1 cd_antigen csf1r_human 569026720 np_001275634.1 p07333 nm_001288705.1 q6ldw5 q6ldy4 q86vw7 b5a955 d3dqg2 gene 221820 samples cell culture supernatants serum plasma sensitivity < 10 factor1 <10
⇄⧉etc_term1 => string (143) "Samples||Serum, plasma and other biological fluids!!Assay Type||Quantitative...
$value[1]['_source']['etc_term1']
Samples||Serum, plasma and other biological fluids!!Assay Type||Quantitative Sandwich!!Detection Range||15.63-1000pg/mL!!Sensitivity||9.38pg/mL
⇄⧉etc_term2 => string (368) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[1]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, mid range and high level Rat MCSF were tested 20 times on one plate, respectively.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, mid range and high level Rat MCSF were tested on 3 different plates, 20 replicates in each plate.
⇄⧉products_description => string (1201) "Intended Uses: This ELISA kit applies to the in vitro quantitative determina...
$value[1]['_source']['products_description']
Intended Uses: This ELISA kit applies to the in vitro quantitative determination of Rat MCSF concentrations in serum, plasma and other biological fluids.<br><br>Principle of the Assay: This ELISA kit uses the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Rat MCSF. Standards or samples are added to the micro ELISA plate wells and combined with the specific antibody. Then a biotinylated detection antibody specific for Rat MCSF and Avidin-Horseradish Peroxidase (HRP) conjugate are added successively to each micro plate well and incubated. Free components are washed away. The substrate solution is added to each well. Only those wells that contain Rat MCSF, biotinylated detection antibody and Avidin-HRP conjugate will appear blue in color. The enzyme-substrate reaction is terminated by the addition of stop solution and the color turns yellow. The optical density (OD) is measured spectrophotometrically at a wavelength of 450 nm +/- 2 nm. The OD value is proportional to the concentration of Rat MCSF. You can calculate the concentration of Rat MCSF in the samples by comparing the OD of the samples to the standard curve.
⇄⧉search_terms => string (680) "aaa21795 rat this kit recognizes mcsf in samples no significant cross reacti...
$value[1]['_source']['search_terms']
aaa21795 rat this kit recognizes mcsf in samples no significant cross reactivity or interference between and analogues was observed typical testing data standard curve for reference only aaa21795_td elisa m csf macrophage colony stimulating factor 1 receptor csf1r csf1 1r r c fms proto oncogene 108,507 da ec:2.7.10.1 cd_antigen cd115 csf1r_felca 57163771 np_001009231.1 p13369 nm_001009231.1 serum plasma other biological fluids assay type quantitative sandwich detection range 15.63 1000pg ml sensitivity 9.38pg intra precision within an 3 with low mid high level were tested 20 times on one plate respectively inter assays different plates replicates each factor1 an3 tested20
⇄⧉specificity => string (177) "This assay has high sensitivity and excellent specificity for detection of R...
$value[2]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of Rat CSF1. No significant cross-reactivity or interference between Rat CSF1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[2]['_source']['purity']
⇄form => string (3) "N/A"
$value[2]['_source']['form']
⇄concentration => string (3) "N/A"
$value[2]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[2]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (391) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[2]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV% is less than 8%<br>Three samples of known concentration were tested twenty times on one plate to assess.<br>Inter-assay Precision (Precision between assays): CV% is less than 10%<br>Three samples of known concentration were tested in twenty assays to assess.!!Detection Wavelength||450 nm!!Sample Volume||50-100ul
⇄⧉products_description => string (931) "<b>For Sample</b>For the quantitative determination of rat macrophage colony...
$value[2]['_source']['products_description']
<b>For Sample</b>For the quantitative determination of rat macrophage colony-stimulating factor (M-CSF) concentrations in serum, plasma, cell culture supernates, tissue homogenates. <br><br><b>PRINCIPLE OF THE ASSAY</b> This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for M-CSF has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any M-CSF present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for M-CSF is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of M-CSF bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉search_terms => string (718) "aaa15055 rat this assay has high sensitivity and excellent specificity for d...
$value[2]['_source']['search_terms']
aaa15055 rat this assay has high sensitivity and excellent specificity for detection of csf1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15055_td elisa kit colony stimulating factor 1 macrophage m csf mcsf mgc31930 otthump00000013363 otthump00000013364 62,187 da csfm csf1_rat 28201782 q8jzq0.1 q8jzq0 samples serum plasma cell culture supernates tissue homogenates type sandwich range 15.6 pg ml 1000 3.9 intra precision within an cv is less than 8 three known concentration were tested twenty times on one plate to assess inter assays 10 in wavelength 450 nm sample volume 50 100ul factor1 than8 assays10 wavelength450 volume50
⇄⧉products_description => string (830) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[3]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Chicken GM-CSF monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
Amoebiasis Pathway||167324!!Amoebiasis Pathway||167191!!Calcineurin-regulated NFAT-dependent Transcription In Lymphocytes Pathway||137993!!Calcium Signaling In The CD4+ TCR Pathway||137941!!Cytokine Signaling In Immune System Pathway||366171!!Cytokine-cytokine Receptor Interaction Pathway||83051!!Cytokine-cytokine Receptor Interaction Pathway||460!!Cytokines And Inflammatory Response Pathway||198794!!Fc Epsilon RI Signaling Pathway||83082!!Fc Epsilon RI Signaling Pathway||493
⇄⧉search_terms => string (433) "aaa12941 chicken typical testing data standard curve for reference only aaa1...
$value[3]['_source']['search_terms']
aaa12941 chicken typical testing data standard curve for reference only aaa12941_sc elisa kit granulocyte macrophage colony stimulating factor gm csf 2 csf2 gmcsf molgramostin sargramostim 16,295 da csf2_human 27437030 np_000749.2 p04141 nm_000758.3 q14ce8 q2vpi8 q8nfi6 138960 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 2000 pg ml 31.2 sensitivity up to 12 intra precision to12
⇄⧉products_description => string (830) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[4]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Porcine GM-CSF monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
Amoebiasis Pathway||167324!!Amoebiasis Pathway||167191!!Calcineurin-regulated NFAT-dependent Transcription In Lymphocytes Pathway||137993!!Calcium Signaling In The CD4+ TCR Pathway||137941!!Cytokine Signaling In Immune System Pathway||366171!!Cytokine-cytokine Receptor Interaction Pathway||83051!!Cytokine-cytokine Receptor Interaction Pathway||460!!Cytokines And Inflammatory Response Pathway||198794!!Fc Epsilon RI Signaling Pathway||83082!!Fc Epsilon RI Signaling Pathway||493
⇄⧉search_terms => string (431) "aaa12922 porcine typical testing data standard curve for reference only aaa1...
$value[4]['_source']['search_terms']
aaa12922 porcine typical testing data standard curve for reference only aaa12922_sc elisa kit granulocyte macrophage colony stimulating factor gm csf 2 csf2 gmcsf molgramostin sargramostim 16,295 da csf2_human 27437030 np_000749.2 p04141 nm_000758.3 q14ce8 q2vpi8 q8nfi6 138960 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision to5
⇄⧉etc_term1 => string (133) "Samples||Serum, plasma, cell culture supernatants, body fluid and tissue hom...
$value[5]['_source']['etc_term1']
Samples||Serum, plasma, cell culture supernatants, body fluid and tissue homogenate!!Assay Type||Competitive!!Sensitivity||0.1 ng/mL.
⇄⧉etc_term2 => string (201) "Intended Uses||This G-CSFR ELISA kit is a 1.5 hour solid-phase ELISA designe...
$value[5]['_source']['etc_term2']
Intended Uses||This G-CSFR ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Mouse G-CSFR. This ELISA kit for research use only, not for therapeutic applications!
⇄⧉products_description => string (1192) "Principle of the Assay: G-CSFR ELISA kit applies the competitive enzyme immu...
$value[5]['_source']['products_description']
Principle of the Assay: G-CSFR ELISA kit applies the competitive enzyme immunoassay technique utilizing a monoclonal anti-G-CSFR antibody and an G-CSFR-HRP conjugate. The assay sample and buffer are incubated together with G-CSFR-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the G-CSFR concentration since G-CSFR from samples and G-CSFR-HRP conjugate compete for the anti-G-CSFR antibody binding site. Since the number of sites is limited, as more sites are occupied by G-CSFR from the sample, fewer sites are left to bind G-CSFR-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The G-CSFR concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (543) "aaa16101 mouse typical testing data standard curve for reference only aaa161...
$value[5]['_source']['search_terms']
aaa16101 mouse typical testing data standard curve for reference only aaa16101_td elisa kit granulocyte colony stimulating factor receptor gcsfr 3 csf3r cd114 g csf r antigen 86,609 da cd_antigen csf3r_human 485364 aaa63177.1 q99062 gene 162830 immunology samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type competitive sensitivity 0.1 ng ml intended uses this csfr is a 1.5 hour solid phase designed the quantitative determination of research use not therapeutic applications! gcsfr3 sensitivity0.1 a1.5
⇄⧉specificity => string (203) "This assay has high sensitivity and excellent specificity for detection of h...
$value[6]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of human GM-CSF antibody. No significant cross-reactivity or interference between human GM-CSF antibody and analogues was observed.
⇄purity => string (3) "N/A"
$value[6]['_source']['purity']
⇄form => string (3) "N/A"
$value[6]['_source']['form']
⇄concentration => string (3) "N/A"
$value[6]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[6]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[6]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (590) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[6]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. The microtiter plate provided in this kit has been pre-coated with GM-CSF. Standards and samples are pipetted into the wells with a biotin-conjugated GM-CSF and avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GM-CSF antibody bound in the initial step. The color development is stopped and the intensity of the color is measured.
Amoebiasis Pathway||167324!!Amoebiasis Pathway||167191!!Calcineurin-regulated NFAT-dependent Transcription In Lymphocytes Pathway||137993!!Calcium Signaling In The CD4+ TCR Pathway||137941!!Cytokine Signaling In Immune System Pathway||366171!!Cytokine-cytokine Receptor Interaction Pathway||83051!!Cytokine-cytokine Receptor Interaction Pathway||460!!Cytokines And Inflammatory Response Pathway||198794!!Fc Epsilon RI Signaling Pathway||83082!!Fc Epsilon RI Signaling Pathway||493
⇄⧉search_terms => string (536) "aaa14963 human this assay has high sensitivity and excellent specificity for...
$value[6]['_source']['search_terms']
aaa14963 human this assay has high sensitivity and excellent specificity for detection of gm csf antibody no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa14963_td elisa kit anti granulocyte macrophage colony stimulating factor 2 csf2 gmcsf molgramostin sargramostim 16,295 da csf2_human 183364 aaa52578.1 p04141 q14ce8 q2vpi8 q8nfi6 138960 samples serum type quantitative sandwich range 0.625 ng ml 40 < 0.156 intra precision within an cv factor2 ml40
⇄⧉products_description => string (828) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[7]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Porcine PDGF monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (537) "aaa12654 porcine no cross reaction with other factors typical testing data s...
$value[7]['_source']['search_terms']
aaa12654 porcine no cross reaction with other factors typical testing data standard curve for reference only aaa12654_sc elisa kit platelet derived growth factor pdgf beta polypeptide pdgfb sis ssv ibgc5 pdgf2 c 2 subunit b becaplermin chain proto oncogene simian sarcoma viral v homolog 25,502 da inn pdgfb_human 338209 aaa60552.1 p01127 p78431 q15354 q6fhe7 q9uf23 g3xag8 615483 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision c2 to5
⇄⧉products_description => string (831) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[8]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Porcine PDGF-AA monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (550) "aaa13064 porcine no cross reaction with other factors typical testing data s...
$value[8]['_source']['search_terms']
aaa13064 porcine no cross reaction with other factors typical testing data standard curve for reference only aaa13064_sc elisa kit platelet derived growth factor aa pdgfaa beta polypeptide pdgfb sis ssv ibgc5 pdgf2 c pdgf 2 subunit b becaplermin chain proto oncogene simian sarcoma viral v homolog 25,502 da inn pdgfb_human 338209 aaa60552.1 p01127 p78431 q15354 q6fhe7 q9uf23 g3xag8 615483 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 10 ng ml 0.156 sensitivity up to 0.05 intra precision range10
⇄⧉specificity => string (152) "This kit recognizes natural and recombinant Human GCSFR. No significant cros...
$value[9]['_source']['specificity']
This kit recognizes natural and recombinant Human GCSFR. No significant cross-reactivity or interference between Human GCSFR and analogues was observed.
⇄purity => string (3) "N/A"
$value[9]['_source']['purity']
⇄form => string (3) "N/A"
$value[9]['_source']['form']
⇄concentration => string (3) "N/A"
$value[9]['_source']['concentration']
⇄storage_stability => string (20) "Store at 4 degree C."
⇄⧉etc_term2 => string (156) "Intended Uses||This ELISA kit applies to the in vitro quantitative determina...
$value[9]['_source']['etc_term2']
Intended Uses||This ELISA kit applies to the in vitro quantitative determination of Human GCSFR concentrations in serum, plasma and other biological fluids.
⇄⧉products_description => string (1048) "Principle of the Assay: This ELISA kit uses Sandwich-ELISA as the method. Th...
$value[9]['_source']['products_description']
Principle of the Assay: This ELISA kit uses Sandwich-ELISA as the method. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to GCSFR. Standards or samples are added to the appropriate micro ELISA plate wells and combined with the specific antibody. Then a biotinylated detection antibody specific for GCSFR and Avidin-Horseradish Peroxidase (HRP) conjugate is added to each micro plate well successively and incubated. Free components are washed away. The substrate solution is added to each well. Only those wells that contain GCSFR, biotinylated detection antibody and Avidin-HRP conjugate will appear blue in color. The enzyme-substrate reaction is terminated by the addition of a sulphuric acid solution and the color turns yellow. The optical density (OD) is measured spectrophotometrically at a wavelength of 450 nm +/- 2 nm. The OD value is proportional to the concentration of GCSFR. You can calculate the concentration of GCSFR in the samples by comparing the OD of the samples to the standard curve.
⇄⧉search_terms => string (592) "aaa21413 human this kit recognizes natural and recombinant gcsfr no signific...
$value[9]['_source']['search_terms']
aaa21413 human this kit recognizes natural and recombinant gcsfr no significant cross reactivity or interference between analogues was observed typical testing data standard curve for reference only aaa21413_td elisa colony stimulating factor receptor granulocyte isoform d 3 csf3r cd114 antigen g csf r 86,609 da cd_antigen csf3r_human 27437045 np_758519.1 q99062 nm_172313.2 138971 samples serum plasma biological fluids assay type sandwich detection range 0.313 20ng ml sensitivity min 0.188ng max intended uses applies to the in vitro quantitative determination of concentrations other d3
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[10]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[10]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (45) "Immunohistochemistry (IHC), Western Blot (WB)"
$value[10]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[10]['_source']['app_notes']
⇄⧉testing_protocols => string (925) "WB (Western Blot)||FGR monoclonal antibody (M02), clone 3B11. Western Blot a...
$value[10]['_source']['testing_protocols']
WB (Western Blot)||FGR monoclonal antibody (M02), clone 3B11. Western Blot analysis of FGR expression in Raw 264.7 (Cat # L024V1).||AAA26558_WB6.jpg!!WB (Western Blot)||FGR monoclonal antibody (M02), clone 3B11. Western Blot analysis of FGR expression in PC-12 (Cat # L012V1).||AAA26558_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged FGR is approximately 0.1ng/ml as a capture antibody.||AAA26558_APP4.jpg!!WB (Western Blot)||FGR monoclonal antibody (M02), clone 3B11 Western Blot analysis of FGR expression in HeLa (Cat # L013V1).||AAA26558_WB3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]||AAA26558_IHC2.jpg!!Application Data||Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]||AAA26558_APP.jpg
⇄⧉etc_term1 => string (237) "Immunogen||FGR (AAH64382, 1aa-90aa) partial recombinant protein with GST tag...
$value[10]['_source']['etc_term1']
Immunogen||FGR (AAH64382, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA!!Conjugate||PE
⇄⧉products_description => string (698) "This gene is a member of the Src family of protein tyrosine kinases (PTKs). ...
$value[10]['_source']['products_description']
This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]
⇄⧉search_terms => string (947) "aaa26558 mouse monoclonal igg2a,k 3b11 purified supplied as a liquid in pbs ...
$value[10]['_source']['search_terms']
aaa26558 mouse monoclonal igg2a,k 3b11 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes fgr immunohistochemistry ihc western blot wb applications are based on unconjugated antibody testing data immunoperoxidase of to formalin fixed paraffin embedded human lymph node concentration 3 ug ml aaa26558_td aaa26558_ihc2 m02 clone analysis expression hela cat # l013v1 aaa26558_wb3 detection limit for recombinant gst tagged is approximately 0.1ng capture aaa26558_td4 pc 12 l012v1 aaa26558_wb5 raw 264.7 l024v1 aaa26558_wb6 gardner rasheed feline sarcoma viral v oncogene homolog flj43153 mgc75096 src2 c p55c p58c proto src family tyrosine kinase p55 p58 protein 39963676 aah64382 p09769 antibodies kinases immunogen 1aa 90aa partial tag mw the alone 26kd sequence mgcvfckklepvatakedaglegdfrsygaadhygpdptkarpassfahipnysnfssqainpgfldsgtirgvsgigvtlfialydyea conjugate ph7.2 concentration3 pc12
⇄⧉specificity => string (160) "This antibody is produced by immunizing rabbits with a synthetic peptide (KL...
$value[11]['_source']['specificity']
This antibody is produced by immunizing rabbits with a synthetic peptide (KLH-coupled) corresponding to a region of N-terminal residues of mouse GM-CSF-R-alpha.
⇄⧉products_description => string (553) "The granulocyte macrophage-colony-stimulating factor receptor (GM-CSF-R) is ...
$value[11]['_source']['products_description']
The granulocyte macrophage-colony-stimulating factor receptor (GM-CSF-R) is a heterodimer composed of 2 subunits, alphaand beta, and ligand binding to the high-affinity receptor leads to signalling for the multiple actions of GM-CSF on target cells. The GM-CSF receptors are found on the surface of myeloid precursors, granulocytes, mononuclear phagocyte, and also frequently present on the myeloid malignancies. The GM-CSF-R-alpha transduces a signal that results in the proliferation, differentiation, and functional activation of hematopoietic cells.
⇄⧉products_references => string (551) "1. Lanza F, Moretti S, Papa S, et al. Report on the fifth interna tional wor...
$value[11]['_source']['products_references']
1. Lanza F, Moretti S, Papa S, et al. Report on the fifth interna tional workshop on human leukocyte differentiation antigens. Boston, November 3-7, 1993, Haematologica, 1994, 79:374-386. 2. Lanza F, Castagnar B, Rigolin G, et al. Flow cytometry measurement of GM-CSF receptors in acute leukemic blasts, and normal hemopoietic cells. Leukem ia, 1997, 11: 1700-1710. 3. Jubinsky P T, Laurie A S, Nathan D G, et al. Expression and function of the human granulocyte-macrophage colony-stimulating factor receptor alpha sub unit. Blood, 1994, 84:4174-4185.
aaa17988 mouse polyclonal igg affinity purified 1*tbs ph7.4 0.5 bsa 25 glycerol this antibody is produced by immunizing rabbits with a synthetic peptide klh coupled corresponding to region of n terminal residues gm csf r alpha western blot wb immunocytochemistry icc 1:1000 testing data fig analysis on f9 cell lysates using anti aaa17988_td cd116 granulocyte macrophage colony stimulating factor receptor subunit 2 low csf2ra csfgmra csfr ra 70 42kda cd_antigen gmcsfr gmr 160707973 np_034100.2 q00941 nm_009970.2 e9qjx0 preservative 0.05 sodium azide cellular localization membrane positive control ph7.40.5 bsa25 subunit2 ra70
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[12]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[12]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[12]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (45) "Immunohistochemistry (IHC), Western Blot (WB)"
$value[12]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[12]['_source']['app_notes']
⇄⧉testing_protocols => string (925) "WB (Western Blot)||FGR monoclonal antibody (M01), clone 3G10. Western Blot a...
$value[12]['_source']['testing_protocols']
WB (Western Blot)||FGR monoclonal antibody (M01), clone 3G10. Western Blot analysis of FGR expression in Raw 264.7 (Cat # L024V1).||AAA26557_WB6.jpg!!WB (Western Blot)||FGR monoclonal antibody (M01), clone 3G10. Western Blot analysis of FGR expression in PC-12 (Cat # L012V1).||AAA26557_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged FGR is approximately 0.3ng/ml as a capture antibody.||AAA26557_APP4.jpg!!WB (Western Blot)||FGR monoclonal antibody (M01), clone 3G10 Western Blot analysis of FGR expression in HeLa (Cat # L013V1).||AAA26557_WB3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]||AAA26557_IHC2.jpg!!Application Data||Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]||AAA26557_APP.jpg
⇄⧉etc_term1 => string (237) "Immunogen||FGR (AAH64382, 1aa-90aa) partial recombinant protein with GST tag...
$value[12]['_source']['etc_term1']
Immunogen||FGR (AAH64382, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA!!Conjugate||PE
⇄⧉products_description => string (698) "This gene is a member of the Src family of protein tyrosine kinases (PTKs). ...
$value[12]['_source']['products_description']
This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]
⇄⧉search_terms => string (947) "aaa26557 mouse monoclonal igg2a,k 3g10 purified supplied as a liquid in pbs ...
$value[12]['_source']['search_terms']
aaa26557 mouse monoclonal igg2a,k 3g10 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes fgr immunohistochemistry ihc western blot wb applications are based on unconjugated antibody testing data immunoperoxidase of to formalin fixed paraffin embedded human lymph node concentration 3 ug ml aaa26557_td aaa26557_ihc2 m01 clone analysis expression hela cat # l013v1 aaa26557_wb3 detection limit for recombinant gst tagged is approximately 0.3ng capture aaa26557_td4 pc 12 l012v1 aaa26557_wb5 raw 264.7 l024v1 aaa26557_wb6 gardner rasheed feline sarcoma viral v oncogene homolog flj43153 mgc75096 src2 c p55c p58c proto src family tyrosine kinase p55 p58 protein 39963676 aah64382 p09769 antibodies kinases immunogen 1aa 90aa partial tag mw the alone 26kd sequence mgcvfckklepvatakedaglegdfrsygaadhygpdptkarpassfahipnysnfssqainpgfldsgtirgvsgigvtlfialydyea conjugate ph7.2 concentration3 pc12
⇄specificity => string (61) "Recognizes human FGR. Species Crossreactivity: mouse and rat."
$value[13]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[13]['_source']['purity']
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[13]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[13]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[13]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (67) "ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)"
$value[13]['_source']['app_tested']
⇄app_notes => string (65) "IHC-P: 3ug/ml<br>Applications are based on unconjugated antibody."
$value[13]['_source']['app_notes']
⇄⧉testing_protocols => string (935) "Application Data||Detection limit for recombinant GST tagged FGR is ~0.3ng/m...
$value[13]['_source']['testing_protocols']
Application Data||Detection limit for recombinant GST tagged FGR is ~0.3ng/ml as a capture antibody.||AAA25687_APP7.jpg!!IHC (Immunohistchemistry)||Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3ug/ml.||AAA25687_IHC6.jpg!!WB (Western Blot)||Western Blot analysis of FGR expression in transfected 293T cell line by FGR monoclonal antibody. Lane 1: FGR transfected lysate (59.5kD). Lane 2: Non-transfected lysate.||AAA25687_WB5.jpg!!WB (Western Blot)||FGR monoclonal antibody. Western Blot analysis of FGR expression in Raw 264.7.||AAA25687_WB4.jpg!!WB (Western Blot)||FGR monoclonal antibody. Western Blot analysis of FGR expression in PC-12.||AAA25687_WB3.jpg!!WB (Western Blot)||FGR monoclonal antibody. Western Blot analysis of FGR expression in HeLa.||AAA25687_WB2.jpg!!WB (Western Blot)||Western Blot detection against Immunogen (35.53kD).||AAA25687_WB.jpg
⇄⧉etc_term1 => string (254) "Immunogen||Partial recombinant corresponding to aa1-90 from human FGR (AAH64...
$value[13]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa1-90 from human FGR (AAH64382) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA!!Conjugate||PE
⇄⧉search_terms => string (1077) "aaa25687 mouse human rat monoclonal igg2a,k 1b12 purified by protein a affin...
$value[13]['_source']['search_terms']
aaa25687 mouse human rat monoclonal igg2a,k 1b12 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes fgr species crossreactivity and elisa eia immunohistochemistry ihc paraffin western blot wb p 3ug ml applications are based on unconjugated antibody detection against immunogen 35.53kd aaa25687_wb analysis of expression hela aaa25687_wb2 pc 12 aaa25687_wb3 raw 264.7 aaa25687_wb4 transfected 293t cell line lane 1 lysate 59.5kd 2 non aaa25687_wb5 immunoperoxidase to formalin fixed embedded spleen concentration aaa25687_ihc6 testing data limit for recombinant gst tagged is ~0.3ng capture aaa25687_td7 tyrosine kinase gardner rasheed feline sarcoma viral v oncogene homolog proto c p55 p58 p58c src2 homo sapiens mrna src family p55c 39963675 bc064382 aah64382 p09769 antibodies kinases partial corresponding aa1 90 from tag mw the alone 26kd sequence mgcvfckklepvatakedaglegdfrsygaadhygpdptkarpassfahipnysnfssqainpgfldsgtirgvsgigvtlfialydyea conjugate ph7.2 pc12 lane1 59.5kd2 aa190
⇄⧉form => string (99) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alk...
$value[14]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
⇄concentration => string (3) "N/A"
$value[14]['_source']['concentration']
⇄⧉storage_stability => string (304) "Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 mont...
$value[14]['_source']['storage_stability']
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (45) "Immunohistochemistry (IHC), Western Blot (WB)"
$value[14]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[14]['_source']['app_notes']
⇄⧉testing_protocols => string (880) "WB (Western Blot)||FGR monoclonal antibody (M01), clone 3G10. Western Blot a...
$value[14]['_source']['testing_protocols']
WB (Western Blot)||FGR monoclonal antibody (M01), clone 3G10. Western Blot analysis of FGR expression in Raw 264.7.||AAA25892_WB6.jpg!!WB (Western Blot)||FGR monoclonal antibody (M01), clone 3G10. Western Blot analysis of FGR expression in PC-12.||AAA25892_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged FGR is approximately 0.3ng/ml as a capture antibody.||AAA25892_APP4.jpg!!WB (Western Blot)||FGR monoclonal antibody (M01), clone 3G10 Western Blot analysis of FGR expression in HeLa.||AAA25892_WB3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]||AAA25892_IHC2.jpg!!Application Data||Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]||AAA25892_APP.jpg
⇄⧉etc_term1 => string (237) "Immunogen||FGR (AAH64382, 1aa-90aa) partial recombinant protein with GST tag...
$value[14]['_source']['etc_term1']
Immunogen||FGR (AAH64382, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA!!Conjugate||AP
⇄⧉products_description => string (698) "This gene is a member of the Src family of protein tyrosine kinases (PTKs). ...
$value[14]['_source']['products_description']
This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]
⇄⧉search_terms => string (925) "aaa25892 mouse monoclonal igg2a,k 3g10 purified supplied as a liquid in pbs ...
$value[14]['_source']['search_terms']
aaa25892 mouse monoclonal igg2a,k 3g10 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with alkaline phosphatase ap recognizes fgr immunohistochemistry ihc western blot wb applications are based on unconjugated antibody testing data immunoperoxidase of to formalin fixed paraffin embedded human lymph node concentration 3 ug ml aaa25892_td aaa25892_ihc2 m01 clone analysis expression hela aaa25892_wb3 detection limit for recombinant gst tagged is approximately 0.3ng capture aaa25892_td4 pc 12 aaa25892_wb5 raw 264.7 aaa25892_wb6 gardner rasheed feline sarcoma viral v oncogene homolog flj43153 mgc75096 src2 c p55c p58c proto src family tyrosine kinase p55 p58 protein 39963676 aah64382 p09769 antibodies kinases immunogen 1aa 90aa partial tag mw the alone 26kd sequence mgcvfckklepvatakedaglegdfrsygaadhygpdptkarpassfahipnysnfssqainpgfldsgtirgvsgigvtlfialydyea conjugate ph7.2 concentration3 pc12
⇄⧉products_description => string (825) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[15]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Rat G-CSF monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[15]['_source']['products_references']
⇄⧉products_related_diseases => string (226) "Disease Susceptibility||6!!Nervous System Diseases||4!!Neutropenia||3!!Leuko...
⇄⧉search_terms => string (452) "aaa12821 rat no cross reaction with other factors typical testing data stand...
$value[15]['_source']['search_terms']
aaa12821 rat no cross reaction with other factors typical testing data standard curve for reference only aaa12821_sc elisa kit granulocyte colony stimulating factor g csf 3 csf3 gcsf csf3os c17orf33 filgrastim lenograstim pluripoietin 18,434 da inn csf3_human 183041 aaa35882.1 p09919 a8mxr7 138970 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision to5
⇄⧉specificity => string (171) "This assay has high sensitivity and excellent specificity for detection of F...
$value[16]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of FGFR1. No significant cross-reactivity or interference between FGFR1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[16]['_source']['purity']
⇄form => string (3) "N/A"
$value[16]['_source']['form']
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value[16]['_source']['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value[16]['_source']['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄products_references => string (3) "N/A"
$value[16]['_source']['products_references']
⇄⧉products_related_diseases => string (290) "Nervous System Diseases||155!!Disease Models, Animal||148!!Myeloproliferativ...
⇄⧉search_terms => string (721) "aaa17568 human this assay has high sensitivity and excellent specificity for...
$value[16]['_source']['search_terms']
aaa17568 human this assay has high sensitivity and excellent specificity for detection of fgfr1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa17568_sc elisa kit fibroblast growth factor receptor 1 cd331 flt 2 bfgfr bfgf r cek fgfbr kal kal2 n sam ogd fgfr flgh3 flt2h4 h2 h5 hbgfr basic antigen fms like tyrosine kinase related heparin binding hydroxyaryl protein proto oncogene c fgr soluble variant 91,577 da cek1 fgfr1_chick 45382885 np_990841.1 p21804 nm_205510.1 samples serum plasma tissue homogenates other biological fluids type quantitative sandwich range 0.156 10ng ml 0.094ng intra precision cv<8 inter cv<10 receptor1 flt2
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[17]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[17]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[17]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (45) "Immunohistochemistry (IHC), Western Blot (WB)"
$value[17]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[17]['_source']['app_notes']
⇄⧉testing_protocols => string (880) "WB (Western Blot)||FGR monoclonal antibody (M02), clone 3B11. Western Blot a...
$value[17]['_source']['testing_protocols']
WB (Western Blot)||FGR monoclonal antibody (M02), clone 3B11. Western Blot analysis of FGR expression in Raw 264.7.||AAA26159_WB6.jpg!!WB (Western Blot)||FGR monoclonal antibody (M02), clone 3B11. Western Blot analysis of FGR expression in PC-12.||AAA26159_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged FGR is approximately 0.1ng/ml as a capture antibody.||AAA26159_APP4.jpg!!WB (Western Blot)||FGR monoclonal antibody (M02), clone 3B11 Western Blot analysis of FGR expression in HeLa.||AAA26159_WB3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]||AAA26159_IHC2.jpg!!Application Data||Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]||AAA26159_APP.jpg
⇄⧉etc_term1 => string (241) "Immunogen||FGR (AAH64382, 1aa-90aa) partial recombinant protein with GST tag...
$value[17]['_source']['etc_term1']
Immunogen||FGR (AAH64382, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA!!Conjugate||Biotin
⇄⧉products_description => string (698) "This gene is a member of the Src family of protein tyrosine kinases (PTKs). ...
$value[17]['_source']['products_description']
This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]
⇄⧉search_terms => string (908) "aaa26159 mouse monoclonal igg2a,k 3b11 purified supplied as a liquid in pbs ...
$value[17]['_source']['search_terms']
aaa26159 mouse monoclonal igg2a,k 3b11 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes fgr immunohistochemistry ihc western blot wb applications are based on unconjugated antibody testing data immunoperoxidase of to formalin fixed paraffin embedded human lymph node concentration 3 ug ml aaa26159_td aaa26159_ihc2 m02 clone analysis expression hela aaa26159_wb3 detection limit for recombinant gst tagged is approximately 0.1ng capture aaa26159_td4 pc 12 aaa26159_wb5 raw 264.7 aaa26159_wb6 gardner rasheed feline sarcoma viral v oncogene homolog flj43153 mgc75096 src2 c p55c p58c proto src family tyrosine kinase p55 p58 protein 39963676 aah64382 p09769 antibodies kinases immunogen 1aa 90aa partial tag mw the alone 26kd sequence mgcvfckklepvatakedaglegdfrsygaadhygpdptkarpassfahipnysnfssqainpgfldsgtirgvsgigvtlfialydyea conjugate ph7.2 concentration3 pc12
⇄⧉form => string (80) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Bio...
$value[18]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
⇄concentration => string (3) "N/A"
$value[18]['_source']['concentration']
⇄⧉storage_stability => string (439) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[18]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (45) "Immunohistochemistry (IHC), Western Blot (WB)"
$value[18]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[18]['_source']['app_notes']
⇄⧉testing_protocols => string (880) "WB (Western Blot)||FGR monoclonal antibody (M01), clone 3G10. Western Blot a...
$value[18]['_source']['testing_protocols']
WB (Western Blot)||FGR monoclonal antibody (M01), clone 3G10. Western Blot analysis of FGR expression in Raw 264.7.||AAA26158_WB6.jpg!!WB (Western Blot)||FGR monoclonal antibody (M01), clone 3G10. Western Blot analysis of FGR expression in PC-12.||AAA26158_WB5.jpg!!Application Data||Detection limit for recombinant GST tagged FGR is approximately 0.3ng/ml as a capture antibody.||AAA26158_APP4.jpg!!WB (Western Blot)||FGR monoclonal antibody (M01), clone 3G10 Western Blot analysis of FGR expression in HeLa.||AAA26158_WB3.jpg!!IHC (Immunohistochemistry)||Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]||AAA26158_IHC2.jpg!!Application Data||Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]||AAA26158_APP.jpg
⇄⧉etc_term1 => string (241) "Immunogen||FGR (AAH64382, 1aa-90aa) partial recombinant protein with GST tag...
$value[18]['_source']['etc_term1']
Immunogen||FGR (AAH64382, 1aa-90aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA!!Conjugate||Biotin
⇄⧉products_description => string (698) "This gene is a member of the Src family of protein tyrosine kinases (PTKs). ...
$value[18]['_source']['products_description']
This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq]
⇄⧉search_terms => string (908) "aaa26158 mouse monoclonal igg2a,k 3g10 purified supplied as a liquid in pbs ...
$value[18]['_source']['search_terms']
aaa26158 mouse monoclonal igg2a,k 3g10 purified supplied as a liquid in pbs ph 7.2 no preservative added labeled with biotin recognizes fgr immunohistochemistry ihc western blot wb applications are based on unconjugated antibody testing data immunoperoxidase of to formalin fixed paraffin embedded human lymph node concentration 3 ug ml aaa26158_td aaa26158_ihc2 m01 clone analysis expression hela aaa26158_wb3 detection limit for recombinant gst tagged is approximately 0.3ng capture aaa26158_td4 pc 12 aaa26158_wb5 raw 264.7 aaa26158_wb6 gardner rasheed feline sarcoma viral v oncogene homolog flj43153 mgc75096 src2 c p55c p58c proto src family tyrosine kinase p55 p58 protein 39963676 aah64382 p09769 antibodies kinases immunogen 1aa 90aa partial tag mw the alone 26kd sequence mgcvfckklepvatakedaglegdfrsygaadhygpdptkarpassfahipnysnfssqainpgfldsgtirgvsgigvtlfialydyea conjugate ph7.2 concentration3 pc12
⇄⧉products_description => string (824) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[19]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Rat EGFR monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉search_terms => string (696) "aaa13159 rat no cross reaction with other factors typical testing data stand...
$value[19]['_source']['search_terms']
aaa13159 rat no cross reaction with other factors typical testing data standard curve for reference only aaa13159_sc elisa kit epidermal growth factor receptor egfr erbb her1 mena erbb1 pig61 proto oncogene c 1 cell inhibiting protein 40 proliferation inducing 61 tyrosine kinase avian erythroblastic leukemia viral v erb b homolog 69,228 da egfr_human 326467049 adz75461.1 p00533 o00688 o00732 p06268 q14225 q68gs5 q92795 q9bzs2 q9gzx1 q9h2c9 q9h3c9 q9umd7 gene 211980 samples serum plasma or culture supernatant and organizations in the natural recombinant e cad concentration assay type sandwich detection range 10 ng ml 0.156ng sensitivity 0.05 intra precision c1 protein40 inducing61 range10
