Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Growth Hormone Polyclonal Antibody | anti-HGH antibody

Polyclonal Rabbit Anti Human Growth Hormone

Purity
Greater than 98%.
Purified IgG prepared by affinity chromatography on protein G.
Synonyms
Growth Hormone; Polyclonal Antibody; Polyclonal Rabbit Anti Human Growth Hormone; HGH Antibody; Growth Hormone Polyclonal Rabbit Anti Human Antibody; GH1; GH; GHN; GH-N; hGH-N; Pituitary growth hormone; Growth hormone 1; Somatotropin; anti-HGH antibody
Ordering
For Research Use Only!
Clonality
Polyclonal
Purity/Purification
Greater than 98%.
Purified IgG prepared by affinity chromatography on protein G.
Form/Format
Lyophilized from a sterile filtered (0.2 um) solution containing phosphate buffered saline.
Sequence
FPTI PLSRLFDNAM LRAHRLHQLAFDTYQ EFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNRE ETQQKSNLE LLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLL KDLEEGIQTLMGRLE DGSPRTGQIFKQ TYSK DTNSHNDDALLKNYGLLYCFRK DM DKVETFLRIVQCRSVEGSCGF
Sequence Length
204
Solubility
Add distilled water at 1:2 ratio and let the lyophilized pellet dissolve completely.
Immunogen
IgG Anti HGH has been developed in rabbit using highly pure (>98%) recombinant human HGH expressed in plants.
Related Product Information for anti-HGH antibody
Introduction: GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the growth hormone locus. Mutations in or deletions of the gene lead to growth hormone deficiency and short stature.
Product Categories/Family for anti-HGH antibody

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
23,110 Da
NCBI Official Full Name
growth hormone
UniProt Protein Name
Somatotropin
Protein Family
UniProt Gene Name
gh
UniProt Entry Name
SOMA_ORENI

Uniprot Description

Growth hormone plays an important role in growth control and involved in the regulation of several anabolic processes.

Similar Products

Product Notes

The HGH gh (Catalog #AAA141028) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: FPTI PLSRLFDNAM LRAHRLHQLA FDTYQ  ;EFEEAYIPK EQKYSFLQNP QTSLCFSESI PTPSNRE ETQQKSNLE& nbsp;LLRIS LLLIQSWLEP VQFLRSVFAN SLVYGASDSN VYDLL KDLEEGIQTL MGRLE DGSPRTGQIF KQ TYSK DTNSHNDDAL LKNYGLLYCF RK DM DKVETFLRIV QCRSVEGSCG F. It is sometimes possible for the material contained within the vial of "Growth Hormone, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.