Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GRIN2C expression in transfected 293T cell line by GRIN2C polyclonal antibody. Lane 1: GRIN2C transfected lysate (17.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human GRIN2C Polyclonal Antibody | anti-GRIN2C antibody

GRIN2C (Glutamate Receptor Ionotropic, NMDA 2C, GluN2C, Glutamate [NMDA] Receptor Subunit epsilon-3, N-methyl D-aspartate Receptor Subtype 2C, NMDAR2C, NR2C, NMDAR2C) (AP)

Gene Names
GRIN2C; NR2C; GluN2C; NMDAR2C
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GRIN2C; Polyclonal Antibody; GRIN2C (Glutamate Receptor Ionotropic; NMDA 2C; GluN2C; Glutamate [NMDA] Receptor Subunit epsilon-3; N-methyl D-aspartate Receptor Subtype 2C; NMDAR2C; NR2C; NMDAR2C) (AP); anti-GRIN2C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GRIN2C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GRIN2C antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GRIN2C, aa1-171 (AAH59384.1).
Immunogen Sequence
MGGALGPALLLTSLFGAWAGLGPGQGEQGMTVAVVFSSSGPPQAQFRARLTPQSFLDLPLEIQPLTVGVNTTNPSSLLTQICGLLGAAHVHGIVFEDNVDTEAVAQILDFISSQTHVPILSISGGSAVVLTPKVHVQTHVPSCLRPGTRLGSGVLWFWEAGIRRDGQGGGG
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GRIN2C expression in transfected 293T cell line by GRIN2C polyclonal antibody. Lane 1: GRIN2C transfected lysate (17.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GRIN2C expression in transfected 293T cell line by GRIN2C polyclonal antibody. Lane 1: GRIN2C transfected lysate (17.6kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-GRIN2C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
134,209 Da
NCBI Official Full Name
Homo sapiens glutamate receptor, ionotropic, N-methyl D-aspartate 2C, mRNA
NCBI Official Synonym Full Names
glutamate ionotropic receptor NMDA type subunit 2C
NCBI Official Symbol
GRIN2C
NCBI Official Synonym Symbols
NR2C; GluN2C; NMDAR2C
NCBI Protein Information
glutamate receptor ionotropic, NMDA 2C

NCBI Description

This gene encodes a subunit of the N-methyl-D-aspartate (NMDA) receptor, which is a subtype of ionotropic glutamate receptor. NMDA receptors are found in the central nervous system, are permeable to cations and have an important role in physiological processes such as learning, memory, and synaptic development. The receptor is a tetramer of different subunits (typically heterodimer of subunit 1 with one or more of subunits 2A-D), forming a channel that is permeable to calcium, potassium, and sodium, and whose properties are determined by subunit composition. Alterations in the subunit composition of the receptor are associated with pathophysiological conditions such as Parkinson's disease, Alzheimer's disease, depression, and schizophrenia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013]

Research Articles on GRIN2C

Similar Products

Product Notes

The GRIN2C (Catalog #AAA6380253) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRIN2C (Glutamate Receptor Ionotropic, NMDA 2C, GluN2C, Glutamate [NMDA] Receptor Subunit epsilon-3, N-methyl D-aspartate Receptor Subtype 2C, NMDAR2C, NR2C, NMDAR2C) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GRIN2C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GRIN2C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GRIN2C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.