Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GRIK2 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit GRIK2 Polyclonal Antibody | anti-GRIK2 antibody

GRIK2 antibody - N-terminal region

Gene Names
GRIK2; EAA4; GLR6; MRT6; GLUK6; GLUR6; GluK2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
GRIK2; Polyclonal Antibody; GRIK2 antibody - N-terminal region; anti-GRIK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Specificity
100% homologous to isoforms 1-7.
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLP
Sequence Length
908
Applicable Applications for anti-GRIK2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GRIK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GRIK2 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-GRIK2 Antibody Titration: 2.5ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-GRIK2 antibody
This is a rabbit polyclonal antibody against GRIK2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GRIK2 encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus.
Product Categories/Family for anti-GRIK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102kDa
NCBI Official Full Name
Glutamate receptor ionotropic, kainate 2
NCBI Official Synonym Full Names
glutamate ionotropic receptor kainate type subunit 2
NCBI Official Symbol
GRIK2
NCBI Official Synonym Symbols
EAA4; GLR6; MRT6; GLUK6; GLUR6; GluK2
NCBI Protein Information
glutamate receptor ionotropic, kainate 2
UniProt Protein Name
Glutamate receptor ionotropic, kainate 2
UniProt Gene Name
GRIK2
UniProt Synonym Gene Names
GLUR6; GluK2; EAA4; GluR-6; GluR6
UniProt Entry Name
GRIK2_HUMAN

NCBI Description

Glutamate receptors are the predominant excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. This gene product belongs to the kainate family of glutamate receptors, which are composed of four subunits and function as ligand-activated ion channels. The subunit encoded by this gene is subject to RNA editing at multiple sites within the first and second transmembrane domains, which is thought to alter the structure and function of the receptor complex. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene. Mutations in this gene have been associated with autosomal recessive cognitive disability. [provided by RefSeq, Jul 2008]

Uniprot Description

GluR6: Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L- glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. May be involved in the transmission of light information from the retina to the hypothalamus. Modulates cell surface expression of NETO2. Defects in GRIK2 are the cause of mental retardation autosomal recessive type 6 (MRT6). It is characterized by significantly sub-average general intellectual functioning associated with impairments in adaptative behavior and manifested during the developmental period. In contrast to syndromic or specific mental retardation which also present with associated physical, neurological and/or psychiatric manifestations, intellectual deficiency is the only primary symptom of non-syndromic mental retardation. MRT6 patients display mild to severe mental retardation and psychomotor development delay in early childhood. Patients do not have neurologic problems, congenital malformations, or facial dysmorphism. Body height, weight, and head circumference are normal. Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRIK2 subfamily. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Channel, calcium; Channel, ligand-gated; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 6q16.3

Cellular Component: dendrite cytoplasm; presynaptic membrane; postsynaptic membrane; kainate selective glutamate receptor complex; integral to plasma membrane; dendrite; postsynaptic density; plasma membrane; terminal button; perikaryon; cell junction

Molecular Function: protein homodimerization activity; kainate selective glutamate receptor activity; extracellular-glutamate-gated ion channel activity; ubiquitin conjugating enzyme binding; ubiquitin protein ligase binding; PDZ domain binding

Biological Process: regulation of synaptic transmission; regulation of long-term neuronal synaptic plasticity; synaptic transmission, glutamatergic; behavioral fear response; glutamate signaling pathway; generation of action potential; negative regulation of synaptic transmission, glutamatergic; regulation of short-term neuronal synaptic plasticity; regulation of JNK cascade; receptor clustering; positive regulation of synaptic transmission; cellular calcium ion homeostasis; synaptic transmission; intracellular protein transport; regulation of inhibitory postsynaptic membrane potential; neuron apoptosis; ionotropic glutamate receptor signaling pathway; transport; positive regulation of neuron apoptosis; negative regulation of neuron apoptosis; regulation of excitatory postsynaptic membrane potential

Disease: Mental Retardation, Autosomal Recessive 6

Research Articles on GRIK2

Similar Products

Product Notes

The GRIK2 grik2 (Catalog #AAA3202536) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GRIK2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GRIK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GRIK2 grik2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSRAILDLVQ FFKWKTVTVV YDDSTGLIRL QELIKAPSRY NLRLKIRQLP. It is sometimes possible for the material contained within the vial of "GRIK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.