Western Blot (WB)
(WB Suggested Anti-GASP2 antibody Titration: 1 ug/mLSample Type: Human A549 Whole Cell)
Rabbit GPRASP2 Polyclonal Antibody | anti-GPRASP2 antibody
GPRASP2 Antibody - C-terminal region
Gene Names
GPRASP2; DFNX7; GASP2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
GPRASP2; Polyclonal Antibody; GPRASP2 Antibody - C-terminal region; anti-GPRASP2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IHEISKIAMGMRSASQFTRDFIRDSGVVSLIETLLNYPSSRVRTSFLENM
Sequence Length
838
Applicable Applications for anti-GPRASP2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen for Anti-GPRASP2 antibody is: synthetic peptide directed towards the C-terminal region of Human GASP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-GASP2 antibody Titration: 1 ug/mLSample Type: Human A549 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-GASP2 antibody Titration: 1 ug/mLSample Type: Human A549 Whole Cell)
Related Product Information for anti-GPRASP2 antibody
This is a rabbit polyclonal antibody against GASP2. It was validated on Western Blot
Target Description: This locus represents naturally occurring readthrough transcription among the adjacent armadillo repeat containing, X-linked 5 (ARMCX5), G protein-coupled receptor associated sorting proteins 1 and 2 (GPRASP1 and GPRASP2), basic helix-loop-helix family member b9 (BHLHB9), and long intergenic non-protein coding RNA 630 (LINC00630) genes on chromosome X. Transcripts may make use of multiple alternative promoters and polyadenylation signals in this region. Readthrough transcripts may produce proteins identical to the proteins encoded by GPRASP2 or BHLHB9.
Target Description: This locus represents naturally occurring readthrough transcription among the adjacent armadillo repeat containing, X-linked 5 (ARMCX5), G protein-coupled receptor associated sorting proteins 1 and 2 (GPRASP1 and GPRASP2), basic helix-loop-helix family member b9 (BHLHB9), and long intergenic non-protein coding RNA 630 (LINC00630) genes on chromosome X. Transcripts may make use of multiple alternative promoters and polyadenylation signals in this region. Readthrough transcripts may produce proteins identical to the proteins encoded by GPRASP2 or BHLHB9.
Product Categories/Family for anti-GPRASP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
92 kDa
NCBI Official Full Name
G-protein coupled receptor-associated sorting protein 2
NCBI Official Synonym Full Names
G protein-coupled receptor associated sorting protein 2
NCBI Official Symbol
GPRASP2
NCBI Official Synonym Symbols
DFNX7; GASP2
NCBI Protein Information
G-protein coupled receptor-associated sorting protein 2
UniProt Protein Name
G-protein coupled receptor-associated sorting protein 2
Protein Family
UniProt Gene Name
GPRASP2
UniProt Entry Name
GASP2_HUMAN
NCBI Description
The protein encoded by this gene is a member of a family that regulates the activity of G protein-coupled receptors (GPCRs). The encoded protein has been shown to be capable of interacting with several GPCRs, including the M1 muscarinic acetylcholine receptor and the calcitonin receptor. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, May 2010]
Uniprot Description
GPRASP2: May play a role in regulation of a variety of G-protein coupled receptors. Belongs to the GPRASP family.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: Xq22.1
Cellular Component: cytoplasm
Molecular Function: beta-amyloid binding
Research Articles on GPRASP2
Similar Products
Product Notes
The GPRASP2 gprasp2 (Catalog #AAA3210875) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPRASP2 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPRASP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPRASP2 gprasp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IHEISKIAMG MRSASQFTRD FIRDSGVVSL IETLLNYPSS RVRTSFLENM. It is sometimes possible for the material contained within the vial of "GPRASP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
