Western Blot (WB)
(GPR87 antibody used at 1 ug/ml to detect target protein.)
Rabbit GPR87 Polyclonal Antibody | anti-GPR87 antibody
GPR87 Antibody
Gene Names
GPR87; GPR95; FKSG78; KPG_002
Applications
Western Blot
Purity
Affinity purified
Synonyms
GPR87; Polyclonal Antibody; GPR87 Antibody; Rabbit Polyclonal GPR87 Antibody raised against the N terminal of GPR87; Polyclonal GPR87 antibody; Anti-GPR87 antibody; GPR-87 antibody; GPR95 antibody; G Protein-Coupled Receptor 87 antibody; KPG_002 antibody; GPR-87; FKSG78 antibody; GPR 87; GPR 87 antibody; MGC131898 antibody; anti-GPR87 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
GPR87 antibody was raised against the N terminal of GPR87
Purity/Purification
Affinity purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Sequence Length
358
Applicable Applications for anti-GPR87 antibody
Western Blot (WB)
Application Notes
This is a rabbit polyclonal antibody against GPR87, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein.
WB: 1 ug/ml
WB: 1 ug/ml
Immunogen
GPR87 antibody was raised using the N terminal of GPR87 corresponding to a region with amino acids MGFNLTLAKLPNNELHGQESHNSGNRSDGPGKNTTLHNEFDTIVLPVLYL
Cross-Reactivity
Human
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(GPR87 antibody used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(GPR87 antibody used at 1 ug/ml to detect target protein.)
Related Product Information for anti-GPR87 antibody
G protein-coupled receptors play a role in cell communication. They are characterized by an extracellular N terminus, 7 transmembrane regions, and an intracellular C terminus.
Product Categories/Family for anti-GPR87 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41 kDa (MW of target protein)
NCBI Official Full Name
G-protein coupled receptor 87
NCBI Official Synonym Full Names
G protein-coupled receptor 87
NCBI Official Symbol
GPR87
NCBI Official Synonym Symbols
GPR95; FKSG78; KPG_002
NCBI Protein Information
G-protein coupled receptor 87
UniProt Protein Name
G-protein coupled receptor 87
Protein Family
UniProt Gene Name
GPR87
UniProt Synonym Gene Names
GPR95
UniProt Entry Name
GPR87_HUMAN
NCBI Description
This gene encodes a G protein-coupled receptor and is located in a cluster of G protein-couple receptor genes on chromosome 3. The encoded protein has been shown to be overexpressed in lung squamous cell carcinoma (PMID:18057535) and regulated by p53 (PMID:19602589). [provided by RefSeq, Nov 2011]
Uniprot Description
GPR87: Receptor for lysophosphatidic acid (LPA). Necessary for p53/TP53-dependent survival in response to DNA damage. Belongs to the G-protein coupled receptor 1 family.
Protein type: Receptor, GPCR; Membrane protein, integral; GPCR, family 1; Membrane protein, multi-pass
Chromosomal Location of Human Ortholog: 3q24
Cellular Component: integral to plasma membrane
Molecular Function: purinergic nucleotide receptor activity, G-protein coupled
Biological Process: G-protein coupled receptor protein signaling pathway; negative regulation of adenylate cyclase activity
Research Articles on GPR87
Similar Products
Product Notes
The GPR87 gpr87 (Catalog #AAA5313931) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GPR87 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). This is a rabbit polyclonal antibody against GPR87, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. WB: 1 ug/ml. Researchers should empirically determine the suitability of the GPR87 gpr87 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPR87, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
