Western Blot (WB)
(Figure 1. Western blot analysis of GPCR LGR8 using anti-GPCR LGR8 antibody.Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human SHG-44 whole cell lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GPCR LGR8 antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for GPCR LGR8 at approximately 86KD. The expected band size for GPCR LGR8 is at 86KD.)
Rabbit anti-Human GPCR LGR8/RXFP2 Polyclonal Antibody | anti-RXFP2 antibody
Anti-GPCR LGR8/RXFP2 Antibody
Gene Names
RXFP2; LGR8; GREAT; GPR106; INSL3R; LGR8.1; RXFPR2
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Flow Cytometry, Functional Assay
Purity
Immunogen Affinity Purified
Synonyms
GPCR LGR8/RXFP2; Polyclonal Antibody; Anti-GPCR LGR8/RXFP2 Antibody; Relaxin receptor 2; G-protein coupled receptor 106; G-protein coupled receptor affecting testicular descent; Leucine-rich repeat-containing G-protein coupled receptor 8; Relaxin family peptide receptor 2; RXFP2; GPR106; GREAT; LGR8; anti-RXFP2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized
Sequence Length
730
Applicable Applications for anti-RXFP2 antibody
Western Blot (WB), Immunohistochemistry (IHC) Frozen, Immunocytochemistry (ICC), Flow Cytometry (FC/FACS)
Application Notes
WB: 0.1-0.5 mug/ml
IHC-F: 0.5-1 mug/ml
ICC: 0.5-1 mug/ml
FC/FACS: 1-3ug/1x106 cells
Tested Species: In-house tested species with positive results.
IHC-F: 0.5-1 mug/ml
ICC: 0.5-1 mug/ml
FC/FACS: 1-3ug/1x106 cells
Tested Species: In-house tested species with positive results.
Immunogen
A synthetic peptide corresponding to a sequence of human GPCR LGR8 (MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Relevant Detection Systems
It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-F and ICC.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.
Avoid repeated freezing and thawing.
Western Blot (WB)
(Figure 1. Western blot analysis of GPCR LGR8 using anti-GPCR LGR8 antibody.Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human SHG-44 whole cell lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GPCR LGR8 antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for GPCR LGR8 at approximately 86KD. The expected band size for GPCR LGR8 is at 86KD.)
Western Blot (WB)
(Figure 1. Western blot analysis of GPCR LGR8 using anti-GPCR LGR8 antibody.Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: human SHG-44 whole cell lysate.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GPCR LGR8 antigen affinity purified polyclonal antibody at 0.5 ug/ml overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for GPCR LGR8 at approximately 86KD. The expected band size for GPCR LGR8 is at 86KD.)
Related Product Information for anti-RXFP2 antibody
Description: Rabbit IgG polyclonal antibody for GPCR LGR8 detection. Tested with WB, IHC-F, ICC, FCM in Human.
Background: Relaxin/insulin-like family peptide receptor 2, also known as RXFP2, is a human G-protein coupled receptor. It is mapped to 13q13.1. This gene encodes a member of the GPCR (G protein-coupled, 7-transmembrane receptor) family. Mutations in this gene are associated with cryptorchidism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Background: Relaxin/insulin-like family peptide receptor 2, also known as RXFP2, is a human G-protein coupled receptor. It is mapped to 13q13.1. This gene encodes a member of the GPCR (G protein-coupled, 7-transmembrane receptor) family. Mutations in this gene are associated with cryptorchidism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
References
1. Ars, E., Lo Giacco, D., Bassas, L., Nuti, F., Rajmil, O., Ruiz, P., Garat, J. M., Ruiz-Castane, E., Krausz, C. Further insights into the role of T222P variant of RXFP2 in non-syndromic cryptorchidism in two Mediterranean populations. Int. J. Androl. 34: 333-338, 2010. 2. Ferlin, A., Simonato, M., Bartoloni, L., Rizzo, G., Bettella, A., Dottorini, T., Dallapiccola, B., Foresta, C. The INSL3-LGR8/GREAT ligand-receptor pair in human cryptorchidism. J. Clin. Endocr. Metab. 88: 4273-4279, 2003. 3. Harris, R. M., Finlayson, C., Weiss, J., Fisher, L., Hurley, L., Barrett, T., Emge, D., Bathgate, R. A. D., Agoulnik, A. I., Jameson, J. L. A missense mutation in LRR8 of RXFP2 is associated with cryptorchidism. Mammalian Genome 21: 442-449, 2010.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
83,736 Da
NCBI Official Full Name
relaxin receptor 2 isoform 2
NCBI Official Synonym Full Names
relaxin family peptide receptor 2
NCBI Official Symbol
RXFP2
NCBI Official Synonym Symbols
LGR8; GREAT; GPR106; INSL3R; LGR8.1; RXFPR2
NCBI Protein Information
relaxin receptor 2
UniProt Protein Name
Relaxin receptor 2
Protein Family
UniProt Gene Name
RXFP2
UniProt Synonym Gene Names
GPR106; GREAT; LGR8
NCBI Description
This gene encodes a member of the GPCR (G protein-coupled, 7-transmembrane receptor) family. Mutations in this gene are associated with cryptorchidism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]
Uniprot Description
Receptor for relaxin. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. May also be a receptor for Leydig insulin-like peptide (INSL3).CautionIt is uncertain whether Met-1 or Met-18 is the initiator.
Research Articles on RXFP2
Similar Products
Product Notes
The RXFP2 rxfp2 (Catalog #AAA1751480) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-GPCR LGR8/RXFP2 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GPCR LGR8/RXFP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Frozen, Immunocytochemistry (ICC), Flow Cytometry (FC/FACS). WB: 0.1-0.5 mug/ml IHC-F: 0.5-1 mug/ml ICC: 0.5-1 mug/ml FC/FACS: 1-3ug/1x106 cells Tested Species: In-house tested species with positive results. Researchers should empirically determine the suitability of the RXFP2 rxfp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPCR LGR8/RXFP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
