Rabbit anti-Human, Rat GPBAR1 Polyclonal Antibody | anti-GPBAR1 antibody

GPBAR1 antibody - C-terminal region

Cat. Num. AAA3216316

• Gene Names: GPBAR1; BG37; TGR5; M-BAR; GPCR19; GPR131
• Reactivity: Human, Rat
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: GPBAR1; Polyclonal Antibody; GPBAR1 antibody - C-terminal region; anti-GPBAR1 antibody

• Host: Rabbit
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: AAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQ
• Sequence Length: 330

• Applicable Applications for anti-GPBAR1 antibody: Western Blot (WB)
• Homology: Human: 100%; Rat: 100%
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GPBAR1 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Related Product Information for anti-GPBAR1 antibody

This is a rabbit polyclonal antibody against GPBAR1. It was validated on Western Blot

Target Description: This gene encodes a member of the G protein-coupled receptor (GPCR) superfamily. This enzyme functions as a cell surface receptor for bile acids. Treatment of cells expressing this GPCR with bile acids induces the production of intracellular cAMP, activation of a MAP kinase signaling pathway, and internalization of the receptor. The receptor is implicated in the suppression of macrophage functions and regulation of energy homeostasis by bile acids.

Product Categories/Family for anti-GPBAR1 antibody

Polyclonal; Various

NCBI and Uniprot Product Information

• NCBI GI #: 24850109
• NCBI GeneID: 151306
• NCBI Accession #: NP_733800
• NCBI GenBank Nucleotide #: NM_170699
• UniProt Accession #: Q8TDU6
• Molecular Weight: 35kDa
• NCBI Official Full Name: G-protein coupled bile acid receptor 1
• NCBI Official Synonym Full Names: G protein-coupled bile acid receptor 1
• NCBI Official Symbol: GPBAR1
• NCBI Official Synonym Symbols: BG37; TGR5; M-BAR; GPCR19; GPR131
• NCBI Protein Information: G-protein coupled bile acid receptor 1
• UniProt Protein Name: G-protein coupled bile acid receptor 1
• Protein Family: G-protein coupled bile acid receptor
• UniProt Gene Name: GPBAR1
• UniProt Synonym Gene Names: TGR5; hGPCR19; M-BAR; BG37
• UniProt Entry Name: GPBAR_HUMAN

NCBI Description

This gene encodes a member of the G protein-coupled receptor (GPCR) superfamily. This enzyme functions as a cell surface receptor for bile acids. Treatment of cells expressing this GPCR with bile acids induces the production of intracellular cAMP, activation of a MAP kinase signaling pathway, and internalization of the receptor. The receptor is implicated in the suppression of macrophage functions and regulation of energy homeostasis by bile acids. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

GPBAR1: Receptor for bile acid. Bile acid-binding induces its internalization, activation of extracellular signal-regulated kinase and intracellular cAMP production. May be involved in the suppression of macrophage functions by bile acids. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: cytoplasm; integral to membrane; plasma membrane

Biological Process: G-protein coupled receptor protein signaling pathway