Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human, Rat GPBAR1 Polyclonal Antibody | anti-GPBAR1 antibody

GPBAR1 antibody - C-terminal region

Gene Names
GPBAR1; BG37; TGR5; M-BAR; GPCR19; GPR131
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPBAR1; Polyclonal Antibody; GPBAR1 antibody - C-terminal region; anti-GPBAR1 antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQ
Sequence Length
330
Applicable Applications for anti-GPBAR1 antibody
Western Blot (WB)
Homology
Human: 100%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GPBAR1 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Related Product Information for anti-GPBAR1 antibody
This is a rabbit polyclonal antibody against GPBAR1. It was validated on Western Blot

Target Description: This gene encodes a member of the G protein-coupled receptor (GPCR) superfamily. This enzyme functions as a cell surface receptor for bile acids. Treatment of cells expressing this GPCR with bile acids induces the production of intracellular cAMP, activation of a MAP kinase signaling pathway, and internalization of the receptor. The receptor is implicated in the suppression of macrophage functions and regulation of energy homeostasis by bile acids.
Product Categories/Family for anti-GPBAR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
G-protein coupled bile acid receptor 1
NCBI Official Synonym Full Names
G protein-coupled bile acid receptor 1
NCBI Official Symbol
GPBAR1
NCBI Official Synonym Symbols
BG37; TGR5; M-BAR; GPCR19; GPR131
NCBI Protein Information
G-protein coupled bile acid receptor 1
UniProt Protein Name
G-protein coupled bile acid receptor 1
UniProt Gene Name
GPBAR1
UniProt Synonym Gene Names
TGR5; hGPCR19; M-BAR; BG37
UniProt Entry Name
GPBAR_HUMAN

NCBI Description

This gene encodes a member of the G protein-coupled receptor (GPCR) superfamily. This enzyme functions as a cell surface receptor for bile acids. Treatment of cells expressing this GPCR with bile acids induces the production of intracellular cAMP, activation of a MAP kinase signaling pathway, and internalization of the receptor. The receptor is implicated in the suppression of macrophage functions and regulation of energy homeostasis by bile acids. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

GPBAR1: Receptor for bile acid. Bile acid-binding induces its internalization, activation of extracellular signal-regulated kinase and intracellular cAMP production. May be involved in the suppression of macrophage functions by bile acids. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: cytoplasm; integral to membrane; plasma membrane

Biological Process: G-protein coupled receptor protein signaling pathway

Research Articles on GPBAR1

Similar Products

Product Notes

The GPBAR1 gpbar1 (Catalog #AAA3216316) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPBAR1 antibody - C-terminal region reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GPBAR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GPBAR1 gpbar1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAAVPVAMGL GDQRYTAPWR AAAQRCLQGL WGRASRDSPG PSIAYHPSSQ. It is sometimes possible for the material contained within the vial of "GPBAR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual