Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (SCYL1BP1 polyclonal antibody. Western Blot analysis of SCYL1BP1 expression in human colon.)

Mouse anti-Human GORAB Polyclonal Antibody | anti-GORAB antibody

GORAB (RAB6-interacting Golgin, GO, N-terminal Kinase-like-binding Protein 1, NTKL-binding Protein 1, NTKLBP1, NTKL-BP1, hNTKL-BP1, SCY1-like 1-binding Protein 1, SCYL1-binding Protein 1, SCYL1BP1, SCYL1-BP1)

Gene Names
GORAB; GO; NTKLBP1; SCYL1BP1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
GORAB; Polyclonal Antibody; GORAB (RAB6-interacting Golgin; GO; N-terminal Kinase-like-binding Protein 1; NTKL-binding Protein 1; NTKLBP1; NTKL-BP1; hNTKL-BP1; SCY1-like 1-binding Protein 1; SCYL1-binding Protein 1; SCYL1BP1; SCYL1-BP1); Anti -GORAB (RAB6-interacting Golgin; anti-GORAB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SCYL1BP1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSWAAVLAVAAARFGHFWGCRWPGPMAQGWAGFSEEELRRLKQTKDPFEPQRRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNVQKPPFSSPTLPSHFTLTSPVGDGQPQGIESQPKELGLENSHDGHNNVEILPPKPDCKLEKKKVELQEKSRWEVLQQEQRLMEEKNKRKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYAR
Applicable Applications for anti-GORAB antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human SCYL1BP1, aa1-246 (AAH64945.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(SCYL1BP1 polyclonal antibody. Western Blot analysis of SCYL1BP1 expression in human colon.)

Western Blot (WB) (SCYL1BP1 polyclonal antibody. Western Blot analysis of SCYL1BP1 expression in human colon.)

Western Blot (WB)

(Western Blot analysis of SCYL1BP1 expression in transfected 293T cell line by SCYL1BP1 polyclonal antibody. Lane 1: SCYL1BP1 transfected lysate (27.06kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SCYL1BP1 expression in transfected 293T cell line by SCYL1BP1 polyclonal antibody. Lane 1: SCYL1BP1 transfected lysate (27.06kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-GORAB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
44,993 Da
NCBI Official Full Name
GORAB protein
NCBI Official Synonym Full Names
golgin, RAB6-interacting
NCBI Official Symbol
GORAB
NCBI Official Synonym Symbols
GO; NTKLBP1; SCYL1BP1
NCBI Protein Information
RAB6-interacting golgin; SCYL1-BP1; hNTKL-BP1; NTKL-binding protein 1; SCYL1-binding protein 1; SCY1-like 1 binding protein 1; SCY1-like 1-binding protein 1; N-terminal kinase-like-binding protein 1
UniProt Protein Name
RAB6-interacting golgin
Protein Family
UniProt Gene Name
GORAB
UniProt Synonym Gene Names
NTKLBP1; SCYL1BP1; NTKL-BP1; NTKL-binding protein 1; hNTKL-BP1; SCYL1-BP1
UniProt Entry Name
GORAB_HUMAN

NCBI Description

This gene encodes a member of the golgin family, a group of coiled-coil proteins localized to the Golgi. The encoded protein may function in the secretory pathway. The encoded protein, which also localizes to the cytoplasm, was identified by interactions with the N-terminal kinase-like protein, and thus it may function in mitosis. Mutations in this gene have been associated with geroderma osteodysplastica. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009]

Uniprot Description

Subunit structure: Interacts with SCYL1

By similarity. Interacts with RCHY1 and RAB6A/RAB6. Ref.5 Ref.6

Subcellular location: Cytoplasm. Golgi apparatus Ref.5 Ref.6.

Involvement in disease: Geroderma osteodysplasticum (GO) [MIM:231070]: A rare autosomal recessive disorder characterized by lax, wrinkled skin, joint laxity and a typical face with a prematurely aged appearance. Skeletal signs include severe osteoporosis leading to frequent fractures, malar and mandibular hypoplasia and a variable degree of growth retardation.Note: The disease is caused by mutations affecting the gene represented in this entry.

Sequence similarities: Belongs to the GORAB family.

Caution: It is uncertain whether Met-1 or Met-26 is the initiator.

Research Articles on GORAB

Similar Products

Product Notes

The GORAB gorab (Catalog #AAA649520) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GORAB (RAB6-interacting Golgin, GO, N-terminal Kinase-like-binding Protein 1, NTKL-binding Protein 1, NTKLBP1, NTKL-BP1, hNTKL-BP1, SCY1-like 1-binding Protein 1, SCYL1-binding Protein 1, SCYL1BP1, SCYL1-BP1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GORAB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the GORAB gorab for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSWAAVLAVA AARFGHFWGC RWPGPMAQGW AGFSEEELRR LKQTKDPFEP QRRLPAKKSR QQLQREKALV EQSQKLGLQD GSTSLLPEQL LSAPKQRVNV QKPPFSSPTL PSHFTLTSPV GDGQPQGIES QPKELGLENS HDGHNNVEIL PPKPDCKLEK KKVELQEKSR WEVLQQEQRL MEEKNKRKKA LLAKAIAERS KRTQAETMKL KRIQKELQAL DDMVSADIGI LRNRIDQASL DYSYAR. It is sometimes possible for the material contained within the vial of "GORAB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.