Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GOPC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

Rabbit GOPC Polyclonal Antibody | anti-GOPC antibody

GOPC antibody - middle region

Gene Names
GOPC; CAL; FIG; PIST; GOPC1; dJ94G16.2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GOPC; Polyclonal Antibody; GOPC antibody - middle region; anti-GOPC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RNDLKRPMQAPPGHDQDSLKKSQGVGPIRKVLLLKEDHEGLGISITGGKE
Sequence Length
454
Applicable Applications for anti-GOPC antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GOPC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GOPC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-GOPC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Hela cell lysate)
Related Product Information for anti-GOPC antibody
This is a rabbit polyclonal antibody against GOPC. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GOPC plays a role in intracellular protein trafficking and degradation. GOPC may regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. GOPC may also regulate the intracellular trafficking of the ADR1B receptor. GOPC may play a role in autophagy. Overexpression of GOPC results in CFTR intracellular retention and degradation in the lysosomes.PIST is a PDZ domain-containing Golgi protein. PDZ domains contain approximately 90 amino acids and bind the extreme C terminus of proteins in a sequence-specific manner.[supplied by OMIM].
Product Categories/Family for anti-GOPC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50kDa
NCBI Official Full Name
Golgi-associated PDZ and coiled-coil motif-containing protein isoform b
NCBI Official Synonym Full Names
golgi associated PDZ and coiled-coil motif containing
NCBI Official Symbol
GOPC
NCBI Official Synonym Symbols
CAL; FIG; PIST; GOPC1; dJ94G16.2
NCBI Protein Information
Golgi-associated PDZ and coiled-coil motif-containing protein
UniProt Protein Name
Golgi-associated PDZ and coiled-coil motif-containing protein
UniProt Gene Name
GOPC
UniProt Synonym Gene Names
CAL; FIG; PIST
UniProt Entry Name
GOPC_HUMAN

NCBI Description

This gene encodes a Golgi protein with a PDZ domain. The PDZ domain is globular and proteins which contain them bind other proteins through short motifs near the C-termini. Mice which are deficient in the orthologous protein have globozoospermia and are infertile. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

PIST: a ubiquitously expressed peripheral membrane protein that contains a PDZ domain and two coiled-coil regions. Associates with the Golgi apparatus and plasma membrane, regulating intracellular protein trafficking and degradation. May play a role in autophagy, and regulate the intracellular trafficking of the ADRB1 receptor. Interacts with GOLGA3 and STX6. The PDZ domain is known to mediate interactions with CLCN3-iso2, ACCN3, CFTR, SSTR5, FDZ5, ADRB1, FZD8, GRID2, mGluR5, mGluR1. Mutations of PDZ residues S302D, T304E, K348D, K350E abrogates the ability of PIST to interact with the CFTR C terminus. May regulate CFTR chloride currents and acid-induced ACCN3 currents by modulating cell surface expression of both channels. Overexpression results in CFTR intracellular retention and degradation in the lysosomes. Enriched in synaptosomal and postsynaptic densities (PSD) fractions. Expressed in cell bodies and dendrites of Purkinje cells. Localized at the trans-Golgi network (TGN) of spermatids and the medulla of round spermatides. An oncogenic fusion protein between PIST (aka FIG) and the receptor tyrosine kinase ROS is found in glioblastoma multiform. Unlike other fusion RTK oncogenes, he mechanism of activation of PIST-ROS does not appear to be dimerization. Rather, activation of the fused ROS kinase appears to depend upon translocation to the golgi apparatus: deletion of 2nd coiled-coil region, crucial for Golgi localization, appears to eliminate the transformation capacity of PIST-ROS. Three alternatively spliced human isoforms have been described.

Protein type: Membrane protein, peripheral

Chromosomal Location of Human Ortholog: 6q21

Cellular Component: Golgi membrane; Golgi apparatus; postsynaptic membrane; trans-Golgi network transport vesicle; protein complex; membrane; postsynaptic density; cytoplasm; dendrite; plasma membrane; cell junction

Molecular Function: protein C-terminus binding; protein binding; protein homodimerization activity; frizzled binding

Biological Process: Golgi to plasma membrane transport; protein transport; ER to Golgi vesicle-mediated transport; apical protein localization; regulation of catalytic activity; spermatid nuclear differentiation; protein homooligomerization; cytoplasmic sequestering of CFTR protein

Disease: Spermatogenic Failure 6

Research Articles on GOPC

Similar Products

Product Notes

The GOPC gopc (Catalog #AAA3212635) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GOPC antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GOPC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GOPC gopc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RNDLKRPMQA PPGHDQDSLK KSQGVGPIRK VLLLKEDHEG LGISITGGKE. It is sometimes possible for the material contained within the vial of "GOPC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.