Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GOLPH3LSample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/mlGOLPH3L is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit GOLPH3L Polyclonal Antibody | anti-GOLPH3L antibody

GOLPH3L Antibody - N-terminal region

Gene Names
GOLPH3L; GPP34R
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GOLPH3L; Polyclonal Antibody; GOLPH3L Antibody - N-terminal region; anti-GOLPH3L antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EISKNSEKKMESEEDSNWEKSPDNEDSGDSKDIRLTLMEEVLLLGLKDKE
Sequence Length
285
Applicable Applications for anti-GOLPH3L antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human GOLPH3L
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GOLPH3LSample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/mlGOLPH3L is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (Host: RabbitTarget Name: GOLPH3LSample Type: MCF7 Whole Cell lysatesAntibody Dilution: 1.0ug/mlGOLPH3L is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-GOLPH3L antibody
This is a rabbit polyclonal antibody against GOLPH3L. It was validated on Western Blot

Target Description: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking.
Product Categories/Family for anti-GOLPH3L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
Golgi phosphoprotein 3-like
NCBI Official Synonym Full Names
golgi phosphoprotein 3 like
NCBI Official Symbol
GOLPH3L
NCBI Official Synonym Symbols
GPP34R
NCBI Protein Information
Golgi phosphoprotein 3-like
UniProt Protein Name
Golgi phosphoprotein 3-like
Protein Family
UniProt Gene Name
GOLPH3L
UniProt Synonym Gene Names
GPP34R

NCBI Description

The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking. [provided by RefSeq, Jul 2008]

Uniprot Description

GOLPH3L: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is localized at the Golgi stack and may have a regulatory role in Golgi trafficking. [provided by RefSeq, Jul 2008]

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: cytosol; Golgi cisterna; Golgi membrane; trans-Golgi network; trans-Golgi network membrane

Molecular Function: protein binding

Biological Process: Golgi organization and biogenesis; Golgi to plasma membrane protein transport; Golgi vesicle budding; positive regulation of protein secretion; retrograde vesicle-mediated transport, Golgi to ER

Research Articles on GOLPH3L

Similar Products

Product Notes

The GOLPH3L golph3l (Catalog #AAA3218504) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GOLPH3L Antibody - N-terminal region reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GOLPH3L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GOLPH3L golph3l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EISKNSEKKM ESEEDSNWEK SPDNEDSGDS KDIRLTLMEE VLLLGLKDKE. It is sometimes possible for the material contained within the vial of "GOLPH3L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.