Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GNS MaxPab rabbit polyclonal antibody. Western Blot analysis of GNS expression in human liver.)

Rabbit anti-Human GNS Polyclonal Antibody | anti-GNS antibody

GNS (Glucosamine (N-acetyl)-6-sulfatase, G6S, MGC21274) (AP)

Gene Names
GNS; G6S
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
GNS; Polyclonal Antibody; GNS (Glucosamine (N-acetyl)-6-sulfatase; G6S; MGC21274) (AP); Glucosamine (N-acetyl)-6-sulfatase; MGC21274; anti-GNS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GNS.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GNS antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GNS (NP_002067.1, 1aa-552aa) full-length human protein.
Immunogen Sequence
MRLLPLAPGRLRRGSPRHLPSCSPALLLLVLGGCLGVFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLL
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(GNS MaxPab rabbit polyclonal antibody. Western Blot analysis of GNS expression in human liver.)

Western Blot (WB) (GNS MaxPab rabbit polyclonal antibody. Western Blot analysis of GNS expression in human liver.)

Western Blot (WB)

(GNS MaxPab rabbit polyclonal antibody. Western Blot analysis of GNS expression in mouse kidney.)

Western Blot (WB) (GNS MaxPab rabbit polyclonal antibody. Western Blot analysis of GNS expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of GNS expression in transfected 293T cell line by GNS MaxPab polyclonal antibody.Lane 1: GNS transfected lysate(62.1 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GNS expression in transfected 293T cell line by GNS MaxPab polyclonal antibody.Lane 1: GNS transfected lysate(62.1 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-GNS antibody
The product of this gene is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparan sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder mucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome. [provided by RefSeq]
Product Categories/Family for anti-GNS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62,082 Da
NCBI Official Full Name
N-acetylglucosamine-6-sulfatase
NCBI Official Synonym Full Names
glucosamine (N-acetyl)-6-sulfatase
NCBI Official Symbol
GNS
NCBI Official Synonym Symbols
G6S
NCBI Protein Information
N-acetylglucosamine-6-sulfatase
UniProt Protein Name
N-acetylglucosamine-6-sulfatase
Protein Family
UniProt Gene Name
GNS
UniProt Synonym Gene Names
G6S
UniProt Entry Name
GNS_HUMAN

Uniprot Description

GNS: Defects in GNS are the cause of mucopolysaccharidosis type 3D (MPS3D); also known as Sanfilippo D syndrome. MPS3D is a form of mucopolysaccharidosis type 3, an autosomal recessive lysosomal storage disease due to impaired degradation of heparan sulfate. MPS3 is characterized by severe central nervous system degeneration, but only mild somatic disease. Onset of clinical features usually occurs between 2 and 6 years; severe neurologic degeneration occurs in most patients between 6 and 10 years of age, and death occurs typically during the second or third decade of life. Belongs to the sulfatase family.

Protein type: EC 3.1.6.14; Hydrolase; Glycan Metabolism - glycosaminoglycan degradation

Chromosomal Location of Human Ortholog: 12q14

Cellular Component: lysosomal lumen

Molecular Function: protein binding; N-acetylglucosamine-6-sulfatase activity; sulfuric ester hydrolase activity; metal ion binding

Biological Process: keratan sulfate metabolic process; glycosaminoglycan catabolic process; glycosaminoglycan metabolic process; carbohydrate metabolic process; pathogenesis; keratan sulfate catabolic process

Disease: Mucopolysaccharidosis, Type Iiid

Similar Products

Product Notes

The GNS gns (Catalog #AAA6451025) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNS (Glucosamine (N-acetyl)-6-sulfatase, G6S, MGC21274) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GNS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GNS gns for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GNS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.