Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GNRHRSample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human GNRHR Polyclonal Antibody | anti-GNRHR antibody

GNRHR Antibody-N-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GNRHR; Polyclonal Antibody; GNRHR Antibody-N-terminal region; gonadotropin-releasing hormone receptor; HH7; GRHR; LRHR; LHRHR; GNRHR1; anti-GNRHR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
NSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATF
Applicable Applications for anti-GNRHR antibody
Western Blot (WB)
Protein Size
328 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GNRHR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GNRHRSample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GNRHRSample Tissue: Human 786-0 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GNRHR antibody
Description of Target: This gene encodes the receptor for type 1 gonadotropin-releasing hormone. This receptor is a member of the seven-transmembrane, G-protein coupled receptor (GPCR) family. It is expressed on the surface of pituitary gonadotrope cells as well as lymphocytes, breast, ovary, and prostate. Following binding of gonadotropin-releasing hormone, the receptor associates with G-proteins that activate a phosphatidylinositol-calcium second messenger system. Activation of the receptor ultimately causes the release of gonadotropic luteinizing hormone (LH) and follicle stimulating hormone (FSH). Defects in this gene are a cause of hypogonadotropic hypogonadism (HH). Alternative splicing results in multiple transcript variants encoding different isoforms. More than 18 transcription initiation sites in the 5' region and multiple polyA signals in the 3' region have been identified for this gene.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
38kDa
UniProt Protein Name
Gonadotropin-releasing hormone receptor
UniProt Gene Name
GNRHR
UniProt Synonym Gene Names
GRHR; GnRH receptor; GnRH-R
UniProt Entry Name
GNRHR_HUMAN

Uniprot Description

GNRHR: Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle- stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol- calcium second messenger system. Isoform 2 may act as an inhibitor of GnRH-R signaling. Defects in GNRHR are a cause of idiopathic hypogonadotropic hypogonadism (IHH). IHH is defined as a deficiency of the pituitary secretion of follicle-stimulating hormone and luteinizing hormone, which results in the impairment of pubertal maturation and of reproductive function. Defects in GNRHR are a cause of fertile eunuch syndrome (FEUNS). Fertile eunuch syndrome is a mild phenotypic form of HH going with the presence of normal testicular size and some degree of spermatogenesis. Belongs to the G-protein coupled receptor 1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 4q21.2

Cellular Component: membrane; integral to plasma membrane; plasma membrane

Molecular Function: gonadotropin-releasing hormone receptor activity; peptide binding

Biological Process: G-protein coupled receptor protein signaling pathway; multicellular organismal development

Disease: Hypogonadotropic Hypogonadism 7 With Or Without Anosmia

Similar Products

Product Notes

The GNRHR gnrhr (Catalog #AAA3249898) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNRHR Antibody-N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GNRHR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GNRHR gnrhr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: NSASPEQNQN HCSAINNSIP LMQGNLPTLT LSGKIRVTVT FFLFLLSATF. It is sometimes possible for the material contained within the vial of "GNRHR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.