Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Sample Type: Human thyroidAnti-GNAS antibody IHC staining of human thyroid. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Rabbit GNAS Polyclonal Antibody | anti-GNAS antibody

GNAS antibody - N-terminal region

Gene Names
GNAS; AHO; GSA; GSP; POH; GPSA; NESP; SCG6; SgVI; GNAS1; PITA3; C20orf45
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
GNAS; Polyclonal Antibody; GNAS antibody - N-terminal region; anti-GNAS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VYRATHRLLLLGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSD
Sequence Length
394
Applicable Applications for anti-GNAS antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GNAS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Sample Type: Human thyroidAnti-GNAS antibody IHC staining of human thyroid. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Immunohistochemistry (IHC) (Sample Type: Human thyroidAnti-GNAS antibody IHC staining of human thyroid. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.)

Immunohistochemistry (IHC)

(Rabbit Anti-GNAS AntibodyParaffin Embedded Tissue: Human PancreasAntibody Concentration: 5 ug/ml)

Immunohistochemistry (IHC) (Rabbit Anti-GNAS AntibodyParaffin Embedded Tissue: Human PancreasAntibody Concentration: 5 ug/ml)

Western Blot (WB)

(Sample Type: INS1Lanes :Lane 1: INS1 lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Donkey anti-rabbit-HRPSecondary Antibody Dilution :1:1000Gene Name :GNASSubmitted by :Olivier Costa, Diabetes research center VUB)

Western Blot (WB) (Sample Type: INS1Lanes :Lane 1: INS1 lysatePrimary Antibody Dilution :1:1000Secondary Antibody :Donkey anti-rabbit-HRPSecondary Antibody Dilution :1:1000Gene Name :GNASSubmitted by :Olivier Costa, Diabetes research center VUB)

Western Blot (WB)

(Host: RabbitTarget Name: GNASSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GNASSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GNASSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GNASSample Tissue: Human Jurkat Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GNASSample Tissue: Human Lung TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GNASSample Tissue: Human Lung TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: GNASSample Type: MCF7 Whole CellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/laneGel Concentration: 0.12%)

Western Blot (WB) (Host: RabbitTarget Name: GNASSample Type: MCF7 Whole CellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/laneGel Concentration: 0.12%)

Western Blot (WB)

(WB Suggested Anti-GNAS Antibody Titration: 1 ug/mlPositive Control: MCF-7 whole cell lysatesGNAS is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Western Blot (WB) (WB Suggested Anti-GNAS Antibody Titration: 1 ug/mlPositive Control: MCF-7 whole cell lysatesGNAS is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)
Related Product Information for anti-GNAS antibody
This is a rabbit polyclonal antibody against GNAS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Mutations in GNAS gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contains a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript exists, and this antisense transcript and one of the transcripts are paternally expressed, produce noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants have been found for this gene, but the full-length nature and/or biological validity of some variants have not been determined. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
protein GNAS isoform GNASL
NCBI Official Synonym Full Names
GNAS complex locus
NCBI Official Symbol
GNAS
NCBI Official Synonym Symbols
AHO; GSA; GSP; POH; GPSA; NESP; SCG6; SgVI; GNAS1; PITA3; C20orf45
NCBI Protein Information
protein ALEX; protein GNAS; protein SCG6 (secretogranin VI)
UniProt Protein Name
Guanine nucleotide-binding protein G(s) subunit alpha isoforms short
Protein Family
UniProt Gene Name
GNAS
UniProt Synonym Gene Names
GNAS1; GSP
UniProt Entry Name
GNAS2_HUMAN

NCBI Description

This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contain a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript is produced from an overlapping locus on the opposite strand. One of the transcripts produced from this locus, and the antisense transcript, are paternally expressed noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. [provided by RefSeq, Aug 2012]

Uniprot Description

G-alpha(s): a guanine nucleotide-binding protein of the G12 class of G-alpha proteins. Agonist binding to Gq-coupled receptors may block Akt activation via the release of active G-alpha(q) subunits that inhibit phosphatidylinositol 3-kinase. Heterotrimeric G proteins are composed of 3 units; alpha, beta and gamma. The alpha chain contains the guanine nucleotide binding site.

Protein type: Oncoprotein; G protein; G protein, heterotrimeric alpha G(s); G protein, heterotrimeric; Vesicle; Membrane protein, peripheral

Chromosomal Location of Human Ortholog: 20q13.3

Cellular Component: dendrite; extracellular region; cytosol; ruffle; transport vesicle; membrane; perinuclear region of cytoplasm; cytoplasm; plasma membrane; heterotrimeric G-protein complex; trans-Golgi network membrane; intrinsic to membrane; nucleus

Molecular Function: GTPase activity; corticotropin-releasing hormone receptor 1 binding; ionotropic glutamate receptor binding; insulin-like growth factor receptor binding; signal transducer activity; protein binding; GTP binding; mu-type opioid receptor binding; metal ion binding; G-protein beta/gamma-subunit binding; beta-2 adrenergic receptor binding; D1 dopamine receptor binding; adenylate cyclase activity

Biological Process: developmental growth; positive regulation of osteoclast differentiation; water transport; protein secretion; female pregnancy; embryonic hindlimb morphogenesis; G-protein signaling, adenylate cyclase activating pathway; intracellular transport; positive regulation of cAMP biosynthetic process; DNA methylation; tissue homeostasis; transmembrane transport; endochondral ossification; post-embryonic body morphogenesis; dopamine receptor, adenylate cyclase activating pathway; response to drug; sensory perception of chemical stimulus; negative regulation of multicellular organism growth; multicellular organism growth; adenylate cyclase activation; sensory perception of smell; embryonic cranial skeleton morphogenesis; positive regulation of osteoblast differentiation; cartilage development; energy reserve metabolic process; renal water homeostasis; cAMP biosynthetic process; blood coagulation; cognition; regulation of insulin secretion

Disease: Osseous Heteroplasia, Progressive; Pseudohypoparathyroidism, Type Ic; Pseudopseudohypoparathyroidism; Mccune-albright Syndrome; Acth-independent Macronodular Adrenal Hyperplasia; Pseudohypoparathyroidism, Type Ia; Pseudohypoparathyroidism, Type Ib; Pituitary Adenoma, Growth Hormone-secreting

Research Articles on GNAS

Similar Products

Product Notes

The GNAS gnas (Catalog #AAA3206512) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GNAS antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GNAS can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the GNAS gnas for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VYRATHRLLL LGAGESGKST IVKQMRILHV NGFNGEGGEE DPQAARSNSD. It is sometimes possible for the material contained within the vial of "GNAS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.