Western Blot (WB)
(Western Blot analysis of CSF2 expression in transfected 293T cell line by CSF2 polyclonal antibody. Lane 1: CSF2 transfected lysate (16.3kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human GMCSF Polyclonal Antibody | anti-GMCSF antibody
GMCSF (CSF2, Granulocyte-macrophage Colony-stimulating Factor, GM-CSF, Colony-stimulating Factor, CSF, Molgramostin, Sargramostim) APC
Gene Names
CSF2; CSF; GMCSF
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GMCSF; Polyclonal Antibody; GMCSF (CSF2; Granulocyte-macrophage Colony-stimulating Factor; GM-CSF; Colony-stimulating Factor; CSF; Molgramostin; Sargramostim) APC; anti-GMCSF antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CSF2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-GMCSF antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CSF2, aa1-144 (AAI14000.1).
Immunogen Sequence
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of CSF2 expression in transfected 293T cell line by CSF2 polyclonal antibody. Lane 1: CSF2 transfected lysate (16.3kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of CSF2 expression in transfected 293T cell line by CSF2 polyclonal antibody. Lane 1: CSF2 transfected lysate (16.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GMCSF antibody
The cytokine GM-CSF stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes. Used in myeloid reconstitution following bone marrow transplant, bone marrow transplant engraftment failure or delay, mobilization and following transplantation of autologous peripheral blood progenitor cells, and following induction chemotherapy in older adults with acute myelogenous leukemia.
Product Categories/Family for anti-GMCSF antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,295 Da
NCBI Official Full Name
Colony stimulating factor 2 (granulocyte-macrophage)
NCBI Official Synonym Full Names
colony stimulating factor 2
NCBI Official Symbol
CSF2
NCBI Official Synonym Symbols
CSF; GMCSF
NCBI Protein Information
granulocyte-macrophage colony-stimulating factor
NCBI Description
The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. [provided by RefSeq, Jul 2008]
Research Articles on GMCSF
Similar Products
Product Notes
The GMCSF (Catalog #AAA6379968) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GMCSF (CSF2, Granulocyte-macrophage Colony-stimulating Factor, GM-CSF, Colony-stimulating Factor, CSF, Molgramostin, Sargramostim) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GMCSF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GMCSF for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GMCSF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
