Mouse anti-Human GLUD2 Polyclonal Antibody | anti-GLUD2 antibody

GLUD2 (Glutamate Dehydrogenase 2, GDH2, GLUDP1)

Cat. Num. AAA648485

• Gene Names: GLUD2; GDH2; GLUDP1
• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: GLUD2; Polyclonal Antibody; GLUD2 (Glutamate Dehydrogenase 2; GDH2; GLUDP1); Anti -GLUD2 (Glutamate Dehydrogenase 2; anti-GLUD2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human GLUD2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILGFPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGKHGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYVNAIEKVFKVYSEAGVTFT

• Applicable Applications for anti-GLUD2 antibody: Western Blot (WB), Immunohistochemistry (IHC)
• Application Notes: Suitable for use in Western Blot and Immunohistochemistry.; Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Full length human GLUD2, aa1-264 (AAH05111.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GLUD2 polyclonal antibody. Western Blot analysis of GLUD2 expression in human kidney.)

Western Blot (WB)

(GLUD2 polyclonal antibody. Western Blot analysis of GLUD2 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of GLUD2 expression in transfected 293T cell line by GLUD2 polyclonal antibody. Lane 1: GLUD2 transfected lysate (29.04kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of purified antibody to GLUD2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Related Product Information for anti-GLUD2 antibody

GLUD2, Glutamate dehydrogenase 2, is important for recycling the chief excitatory neurotransmitter, glutamate, during neurotransmission. It is expressed in retina, testis and, at a lower level, brain.

Product Categories/Family for anti-GLUD2 antibody

Antibodies; Abs to Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 31377775
• NCBI GeneID: 2747
• NCBI Accession #: NP_036216.2
• NCBI GenBank Nucleotide #: NM_012084.3
• UniProt Accession #: P49448; Q9UDQ4; B2R8G0
• Molecular Weight: 61,434 Da
• NCBI Official Full Name: glutamate dehydrogenase 2, mitochondrial
• NCBI Official Synonym Full Names: glutamate dehydrogenase 2
• NCBI Official Symbol: GLUD2
• NCBI Official Synonym Symbols: GDH2; GLUDP1
• NCBI Protein Information: glutamate dehydrogenase 2, mitochondrial; GDH 2; glutamate dehydrogenase pseudogene 1
• UniProt Protein Name: Glutamate dehydrogenase 2, mitochondrial
• UniProt Gene Name: GLUD2
• UniProt Synonym Gene Names: GLUDP1; GDH 2
• UniProt Entry Name: DHE4_HUMAN

NCBI Description

The protein encoded by this gene is localized to the mitochondrion and acts as a homohexamer to recycle glutamate during neurotransmission. The encoded enzyme catalyzes the reversible oxidative deamination of glutamate to alpha-ketoglutarate. This gene is intronless.[provided by RefSeq, Jan 2010]

Uniprot Description

Function: Important for recycling the chief excitatory neurotransmitter, glutamate, during neurotransmission.

Catalytic activity: L-glutamate + H2O + NAD(P)+ = 2-oxoglutarate + NH3 + NAD(P)H.

Subunit structure: Homohexamer

By similarity.

Subcellular location: Mitochondrion matrix Ref.7.

Tissue specificity: Expressed in retina, testis and, at a lower level, brain.

Post-translational modification: Stoichiometry shows that ADP-ribosylation occurs in one subunit per catalytically active homohexamer.

Sequence similarities: Belongs to the Glu/Leu/Phe/Val dehydrogenases family.