Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-GJA1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit GJA1 Polyclonal Antibody | anti-GJA1 antibody

GJA1 antibody - middle region

Gene Names
GJA1; HSS; CMDR; CX43; EKVP; GJAL; ODDD; AVSD3; EKVP3; HLHS1; PPKCA
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GJA1; Polyclonal Antibody; GJA1 antibody - middle region; anti-GJA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSTISNSHAQPFDFPDDNQNSKKLAAGHELQPLAIVDQRPSSRASSRASS
Sequence Length
382
Applicable Applications for anti-GJA1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rabbit: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GJA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-GJA1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-GJA1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Thyroid Gland TissueObserved Staining: Plasma membranePrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Lanes:Lane1: 8 ug total cardiac lysateLane2: 15 ug total cardiac lysateLane3: 30 ug total cardiac lysateLane4: 50 ug total cardiac lysatePrimary Antibody Dilution:1 ug/mlSecondary Antibody:Secondary Antibody Dilution:Gene Name:GJA1Submitted by:Anonymous)

Western Blot (WB) (Lanes:Lane1: 8 ug total cardiac lysateLane2: 15 ug total cardiac lysateLane3: 30 ug total cardiac lysateLane4: 50 ug total cardiac lysatePrimary Antibody Dilution:1 ug/mlSecondary Antibody:Secondary Antibody Dilution:Gene Name:GJA1Submitted by:Anonymous)

Western Blot (WB)

(Species+tissue/cell type: Total rat cardiac lysate1: 8 ug total cardiac lysate2: 15 ug total cardiac lysate3: 30 ug total cardiac lysate4: 50 ug total cardiac lysatePrimary antibody dilution: 1 ug/ml)

Western Blot (WB) (Species+tissue/cell type: Total rat cardiac lysate1: 8 ug total cardiac lysate2: 15 ug total cardiac lysate3: 30 ug total cardiac lysate4: 50 ug total cardiac lysatePrimary antibody dilution: 1 ug/ml)

Western Blot (WB)

(WB Suggested Anti-GJA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-GJA1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Liver)
Related Product Information for anti-GJA1 antibody
This is a rabbit polyclonal antibody against GJA1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Gap junction protein, alpha 1 is a member of the connexin gene family and a component of gap junctions. Gap junctions are composed of arrays of intercellular channels and provide a route for the diffusion of materials of low molecular weight from cell to cell. Connexin 43 is the major protein of gap junctions in the heart, and gap junctions are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. Connexin 43 is targeted by several protein kinases that regulate myocardial cell-cell coupling. A related intron-less connexin 43 pseudogene, GJA1P, has been mapped to chromosome 5. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia and heart malformations. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
gap junction alpha-1 protein
NCBI Official Synonym Full Names
gap junction protein alpha 1
NCBI Official Symbol
GJA1
NCBI Official Synonym Symbols
HSS; CMDR; CX43; EKVP; GJAL; ODDD; AVSD3; EKVP3; HLHS1; PPKCA
NCBI Protein Information
gap junction alpha-1 protein
UniProt Protein Name
Gap junction alpha-1 protein
UniProt Gene Name
GJA1
UniProt Synonym Gene Names
GJAL; Cx43
UniProt Entry Name
CXA1_HUMAN

NCBI Description

This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell. The encoded protein is the major protein of gap junctions in the heart that are thought to have a crucial role in the synchronized contraction of the heart and in embryonic development. A related intronless pseudogene has been mapped to chromosome 5. Mutations in this gene have been associated with oculodentodigital dysplasia, autosomal recessive craniometaphyseal dysplasia and heart malformations. [provided by RefSeq, May 2014]

Uniprot Description

GJA1: an integral membrane protein of the connexin family, alpha-type (group II) subfamily. Hexamers of connexin-43 form connexons, which aggregate together to form gap junctions, through which materials of low MW diffuse from one cell to a neighboring cell. May play a critical role in the physiology of hearing by participating in the recycling of potassium to the cochlear endolymph.

Protein type: Channel, misc.; Membrane protein, multi-pass; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 6q22.31

Cellular Component: Golgi apparatus; endoplasmic reticulum membrane; focal adhesion; contractile fiber; lysosome; integral to plasma membrane; early endosome; intermediate filament; fascia adherens; cytosol; lipid raft; Golgi membrane; connexon complex; multivesicular body; mitochondrial outer membrane; apical plasma membrane; plasma membrane; gap junction; lateral plasma membrane

Molecular Function: signal transducer activity; protein binding; ion transmembrane transporter activity; beta-tubulin binding; SH3 domain binding; gap junction channel activity; PDZ domain binding; receptor binding

Biological Process: lens development in camera-type eye; response to peptide hormone stimulus; apoptosis; heart development; neuron migration; milk ejection; signal transduction; positive regulation of vasodilation; elevation of cytosolic calcium ion concentration; cell-cell signaling; muscle contraction; transport; positive regulation of glomerular filtration; negative regulation of cardiac muscle cell proliferation; response to glucose stimulus; positive regulation of striated muscle development; heart looping; ATP transport; adult heart development; chronic inflammatory response; positive regulation of I-kappaB kinase/NF-kappaB cascade; gap junction assembly; in utero embryonic development; epithelial cell maturation; regulation of bone remodeling; positive regulation of insulin secretion; skeletal muscle regeneration; regulation of calcium ion transport; vascular transport; protein oligomerization; osteoblast differentiation; positive regulation of osteoblast differentiation; negative regulation of endothelial cell proliferation; positive regulation of protein catabolic process; positive regulation of vasoconstriction; blood vessel morphogenesis; embryonic digit morphogenesis; regulation of bone mineralization; neurite morphogenesis; response to pH

Disease: Syndactyly, Type Iii; Craniometaphyseal Dysplasia, Autosomal Recessive; Palmoplantar Keratoderma And Congenital Alopecia 1; Atrioventricular Septal Defect 3; Oculodentodigital Dysplasia; Erythrokeratodermia Variabilis Et Progressiva; Oculodentodigital Dysplasia, Autosomal Recessive; Hypoplastic Left Heart Syndrome 1

Research Articles on GJA1

Similar Products

Product Notes

The GJA1 gja1 (Catalog #AAA3203210) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GJA1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GJA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GJA1 gja1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSTISNSHAQ PFDFPDDNQN SKKLAAGHEL QPLAIVDQRP SSRASSRASS. It is sometimes possible for the material contained within the vial of "GJA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.