Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GH2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: PANC1 cell lysateGH2 is supported by BioGPS gene expression data to be expressed in PANC1)

Rabbit anti-Human GH2 Polyclonal Antibody | anti-GH2 antibody

GH2 antibody - middle region

Gene Names
GH2; GHL; GHV; GH-V; GHB2; hGH-V
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GH2; Polyclonal Antibody; GH2 antibody - middle region; anti-GH2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG
Sequence Length
245
Applicable Applications for anti-GH2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GH2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: PANC1 cell lysateGH2 is supported by BioGPS gene expression data to be expressed in PANC1)

Western Blot (WB) (WB Suggested Anti-GH2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: PANC1 cell lysateGH2 is supported by BioGPS gene expression data to be expressed in PANC1)
Related Product Information for anti-GH2 antibody
This is a rabbit polyclonal antibody against GH2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: GH2 is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. Mutations in its gene lead to placental growth hormone/lactogen deficiency.
Product Categories/Family for anti-GH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
growth hormone variant isoform 3
NCBI Official Synonym Full Names
growth hormone 2
NCBI Official Symbol
GH2
NCBI Official Synonym Symbols
GHL; GHV; GH-V; GHB2; hGH-V
NCBI Protein Information
growth hormone variant
Protein Family

NCBI Description

The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the growth hormone locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five growth hormones, leading to further diversity and potential for specialization. As in the case of its pituitary counterpart, growth hormone 1, the predominant isoform of this particular family member shows similar somatogenic activity, with reduced lactogenic activity. Mutations in this gene lead to placental growth hormone/lactogen deficiency. [provided by RefSeq, Jul 2008]

Research Articles on GH2

Similar Products

Product Notes

The GH2 (Catalog #AAA3206466) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GH2 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GH2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEEGIQTLIG WKMAAPGLGR SSISPTASLT QNRTTMTHCS RTTGCSTASG. It is sometimes possible for the material contained within the vial of "GH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.