Western Blot (WB)
(Western Blot analysis of GFOD2 expression in transfected 293T cell line by GFOD2 polyclonal antibody. Lane 1: MGC11335 transfected lysate (30.8kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human GFOD2 Polyclonal Antibody | anti-GFOD2 antibody
GFOD2 (Glucose-fructose Oxidoreductase Domain-containing Protein 2, UNQ9430/PRO34691, FLJ23802, MGC11335)
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
GFOD2; Polyclonal Antibody; GFOD2 (Glucose-fructose Oxidoreductase Domain-containing Protein 2; UNQ9430/PRO34691; FLJ23802; MGC11335); Anti -GFOD2 (Glucose-fructose Oxidoreductase Domain-containing Protein 2; anti-GFOD2 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GFOD2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MVTASRYYPQLMSLVGNVLRFLPAFVRMKQLISEHYVGAVMICDARIYSGSLLSPSYGWICDELMGGGGLHTMGTYIVDLLTHLTGRRAEKVHGLLKTFVRQNAAIRGIRHVTSDDFCFFQMLMGGGVCSTVTLNFNMPGAFVHEVMVVGSAGRLVARGADLYGQKNSATQEELLLRDSLAVGAGLPEQGPQDVPLLYLKGMVYMVQALRQSFQGQGDRRTWDRTPVSMAASFEDGLYMQSVVDAIKRSSRSGEWEAVEVLTEEPDTNQNLCEALQRNNL
Applicable Applications for anti-GFOD2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human GFOD2, aa1-280 (AAH00757.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of GFOD2 expression in transfected 293T cell line by GFOD2 polyclonal antibody. Lane 1: MGC11335 transfected lysate (30.8kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of GFOD2 expression in transfected 293T cell line by GFOD2 polyclonal antibody. Lane 1: MGC11335 transfected lysate (30.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GFOD2 antibody
Promotes matrix assembly.
Product Categories/Family for anti-GFOD2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
42,255 Da
NCBI Official Full Name
GFOD2 protein
NCBI Official Synonym Full Names
glucose-fructose oxidoreductase domain containing 2
NCBI Official Symbol
GFOD2
NCBI Protein Information
glucose-fructose oxidoreductase domain-containing protein 2
UniProt Protein Name
Glucose-fructose oxidoreductase domain-containing protein 2
Protein Family
UniProt Gene Name
GFOD2
UniProt Entry Name
GFOD2_HUMAN
Uniprot Description
GFOD2: Promotes matrix assembly. Belongs to the Gfo/Idh/MocA family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 1.-.-.-; Secreted, signal peptide; Extracellular matrix; Oxidoreductase; Secreted
Chromosomal Location of Human Ortholog: 16q22.1
Cellular Component: proteinaceous extracellular matrix
Molecular Function: oxidoreductase activity
Biological Process: extracellular matrix organization and biogenesis
Similar Products
Product Notes
The GFOD2 gfod2 (Catalog #AAA6012957) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GFOD2 (Glucose-fructose Oxidoreductase Domain-containing Protein 2, UNQ9430/PRO34691, FLJ23802, MGC11335) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GFOD2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the GFOD2 gfod2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVTASRYYPQ LMSLVGNVLR FLPAFVRMKQ LISEHYVGAV MICDARIYSG SLLSPSYGWI CDELMGGGGL HTMGTYIVDL LTHLTGRRAE KVHGLLKTFV RQNAAIRGIR HVTSDDFCFF QMLMGGGVCS TVTLNFNMPG AFVHEVMVVG SAGRLVARGA DLYGQKNSAT QEELLLRDSL AVGAGLPEQG PQDVPLLYLK GMVYMVQALR QSFQGQGDRR TWDRTPVSMA ASFEDGLYMQ SVVDAIKRSS RSGEWEAVEV LTEEPDTNQN LCEALQRNNL. It is sometimes possible for the material contained within the vial of "GFOD2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
