Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ALRSample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human GFER Polyclonal Antibody | anti-GFER antibody

GFER Antibody - C-terminal region

Gene Names
GFER; ALR; HPO; HSS; ERV1; HPO1; HPO2; HERV1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GFER; Polyclonal Antibody; GFER Antibody - C-terminal region; anti-GFER antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDG
Sequence Length
205
Applicable Applications for anti-GFER antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ALR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ALRSample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ALRSample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GFER antibody
This is a rabbit polyclonal antibody against ALR. It was validated on Western Blot

Target Description: The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene.
Product Categories/Family for anti-GFER antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22kDa
NCBI Official Full Name
FAD-linked sulfhydryl oxidase ALR
NCBI Official Synonym Full Names
growth factor, augmenter of liver regeneration
NCBI Official Symbol
GFER
NCBI Official Synonym Symbols
ALR; HPO; HSS; ERV1; HPO1; HPO2; HERV1
NCBI Protein Information
FAD-linked sulfhydryl oxidase ALR
UniProt Protein Name
FAD-linked sulfhydryl oxidase ALR
UniProt Gene Name
GFER
UniProt Synonym Gene Names
ALR; HERV1; HPO; hERV1
UniProt Entry Name
ALR_HUMAN

NCBI Description

The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene. [provided by RefSeq, Jul 2008]

Uniprot Description

GFER: Isoform 1: FAD-dependent sulfhydryl oxidase. Within the mitochondrial intermembrane space, participates in a chain of disulfide exchange reactions with MIA40, that generate disulfide bonds in a number of resident proteins with twin Cx3C and Cx9C motifs. Defects in GFER are a cause of mitochondrial progressive myopathy with congenital cataract hearing loss and developmental delay (MPMCHD); also called combined mitochondrial complex deficiency. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; EC 1.8.3.2; Oxidoreductase

Chromosomal Location of Human Ortholog: 16p13.3-p13.12

Cellular Component: mitochondrion; cytoplasm; extracellular region; mitochondrial intermembrane space

Molecular Function: protein binding; FAD binding; growth factor activity; thiol oxidase activity; protein disulfide oxidoreductase activity

Biological Process: cellular protein metabolic process; protein targeting to mitochondrion

Disease: Myopathy, Mitochondrial Progressive, With Congenital Cataract, Hearing Loss, And Developmental Delay

Research Articles on GFER

Similar Products

Product Notes

The GFER gfer (Catalog #AAA3215182) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GFER Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GFER can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GFER gfer for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LCRNHPDTRT RACFTQWLCH LHNEVNRKLG KPDFDCSKVD ERWRDGWKDG. It is sometimes possible for the material contained within the vial of "GFER, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.