Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GEMIN7 rabbit polyclonal antibody. Western Blot analysis of GEMIN7 expression in mouse kidney.)

Rabbit anti-Human, Mouse GEMIN7 Polyclonal Antibody | anti-GEMIN7 antibody

GEMIN7 (Gem-associated Protein 7, Gemin-7, SIP3) (Biotin)

Gene Names
GEMIN7; SIP3
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GEMIN7; Polyclonal Antibody; GEMIN7 (Gem-associated Protein 7; Gemin-7; SIP3) (Biotin); anti-GEMIN7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GEMIN7. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GEMIN7 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GEMIN7, aa1-131 (NP_001007270.1).
Immunogen Sequence
MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GEMIN7 rabbit polyclonal antibody. Western Blot analysis of GEMIN7 expression in mouse kidney.)

Western Blot (WB) (GEMIN7 rabbit polyclonal antibody. Western Blot analysis of GEMIN7 expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of GEMIN7 expression in transfected 293T cell line by GEMIN7 polyclonal antibody. Lane 1: GEMIN7 transfected lysate (14.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GEMIN7 expression in transfected 293T cell line by GEMIN7 polyclonal antibody. Lane 1: GEMIN7 transfected lysate (14.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GEMIN7 antibody
The protein encoded by this gene is a component of the core SMN complex, which is required for pre-mRNA splicing in the nucleus. The encoded protein is found in the nucleoplasm, in nuclear "gems" (Gemini of Cajal bodies) and in the cytoplasm.
Product Categories/Family for anti-GEMIN7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,537 Da
NCBI Official Full Name
gem-associated protein 7
NCBI Official Synonym Full Names
gem (nuclear organelle) associated protein 7
NCBI Official Symbol
GEMIN7
NCBI Official Synonym Symbols
SIP3
NCBI Protein Information
gem-associated protein 7; gemin 7; gemin-7
UniProt Protein Name
Gem-associated protein 7
Protein Family
UniProt Gene Name
GEMIN7
UniProt Synonym Gene Names
Gemin-7
UniProt Entry Name
GEMI7_HUMAN

Uniprot Description

GEMIN7: The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. Belongs to the gemin-7 family.

Protein type: RNA splicing

Chromosomal Location of Human Ortholog: 19q13.32

Cellular Component: nucleoplasm; nuclear body; cytoplasm; SMN complex; nucleus; cytosol

Molecular Function: protein binding

Biological Process: nuclear mRNA splicing, via spliceosome; spliceosomal snRNP biogenesis; gene expression

Similar Products

Product Notes

The GEMIN7 gemin7 (Catalog #AAA6379705) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GEMIN7 (Gem-associated Protein 7, Gemin-7, SIP3) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GEMIN7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GEMIN7 gemin7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GEMIN7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.