Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GDPD5Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit GDPD5 Polyclonal Antibody | anti-GDPD5 antibody

GDPD5 Antibody - middle region

Gene Names
GDPD5; GDE2; PP1665
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GDPD5; Polyclonal Antibody; GDPD5 Antibody - middle region; anti-GDPD5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VFALYLAPLTISSPCIMEKKDLGPKPALIGHRGAPMLAPEHTLMSFRKAL
Sequence Length
387
Applicable Applications for anti-GDPD5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human GDPD5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GDPD5Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GDPD5Sample Type: COLO205 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GDPD5 antibody
This is a rabbit polyclonal antibody against GDPD5. It was validated on Western Blot

Target Description: Glycerophosphodiester phosphodiesterases, such as GDPD5, are involved in glycerol metabolism.
Product Categories/Family for anti-GDPD5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
glycerophosphodiester phosphodiesterase domain-containing protein 5 isoform 1
NCBI Official Synonym Full Names
glycerophosphodiester phosphodiesterase domain containing 5
NCBI Official Symbol
GDPD5
NCBI Official Synonym Symbols
GDE2; PP1665
NCBI Protein Information
glycerophosphodiester phosphodiesterase domain-containing protein 5
UniProt Protein Name
Glycerophosphodiester phosphodiesterase domain-containing protein 5
UniProt Gene Name
GDPD5
UniProt Synonym Gene Names
GDE2
UniProt Entry Name
GDPD5_HUMAN

NCBI Description

Glycerophosphodiester phosphodiesterases (GDPDs; EC 3.1.4.46), such as GDPD5, are involved in glycerol metabolism (Lang et al., 2008 [PubMed 17578682]).[supplied by OMIM, Jan 2010]

Uniprot Description

GDPD5: Promotes neurite formation. Cooperates with PRDX1 to drive postmitotic motor neuron differentiation. The glycerophosphodiester phosphodiesterase activity may be required for its role in neuronal differentiation. May contribute to the osmotic regulation of cellular glycerophosphocholine. Belongs to the glycerophosphoryl diester phosphodiesterase family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; EC 3.1.-.-; Membrane protein, integral; Phosphodiesterase

Chromosomal Location of Human Ortholog: 11q13.4-q13.5

Cellular Component: growth cone; perinuclear region of cytoplasm; integral to membrane; endomembrane system

Molecular Function: glycerophosphodiester phosphodiesterase activity

Biological Process: glycerol metabolic process; negative regulation of Notch signaling pathway; lipid metabolic process; spinal cord motor neuron differentiation; positive regulation of neuron differentiation; regulation of timing of cell differentiation; neurite development; cerebral cortex neuron differentiation

Research Articles on GDPD5

Similar Products

Product Notes

The GDPD5 gdpd5 (Catalog #AAA3209726) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GDPD5 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GDPD5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GDPD5 gdpd5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VFALYLAPLT ISSPCIMEKK DLGPKPALIG HRGAPMLAPE HTLMSFRKAL. It is sometimes possible for the material contained within the vial of "GDPD5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.