Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GCHFRSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human GCHFR Polyclonal Antibody | anti-GCHFR antibody

GCHFR Antibody - middle region

Gene Names
GCHFR; P35; GFRP; HsT16933
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GCHFR; Polyclonal Antibody; GCHFR Antibody - middle region; anti-GCHFR antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDDPPRIVLDKLERRGF
Sequence Length
84
Applicable Applications for anti-GCHFR antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GCHFR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GCHFRSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GCHFRSample Tissue: Human OVCAR-3 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GCHFR antibody
GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide.
Product Categories/Family for anti-GCHFR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
9 kDa
NCBI Official Full Name
GTP cyclohydrolase 1 feedback regulatory protein
NCBI Official Synonym Full Names
GTP cyclohydrolase I feedback regulator
NCBI Official Symbol
GCHFR
NCBI Official Synonym Symbols
P35; GFRP; HsT16933
NCBI Protein Information
GTP cyclohydrolase 1 feedback regulatory protein
UniProt Protein Name
GTP cyclohydrolase 1 feedback regulatory protein
UniProt Gene Name
GCHFR
UniProt Synonym Gene Names
GFRP; GFRP
UniProt Entry Name
GFRP_HUMAN

NCBI Description

GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide. [provided by RefSeq, Jul 2008]

Uniprot Description

GCHFR: Mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase 1. This inhibition is reversed by L-phenylalanine. Belongs to the GFRP family.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 15q15

Cellular Component: nuclear membrane; protein complex; cytoplasm; dendrite; melanosome; nucleus; cytosol

Molecular Function: enzyme inhibitor activity; amino acid binding; protein binding; GTP-dependent protein binding

Biological Process: negative regulation of biosynthetic process; neurotransmitter metabolic process; protein heterooligomerization; negative regulation of GTP cyclohydrolase I activity; regulation of nitric-oxide synthase activity; nitric oxide biosynthetic process; nitric oxide metabolic process

Research Articles on GCHFR

Similar Products

Product Notes

The GCHFR gchfr (Catalog #AAA3223420) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GCHFR Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GCHFR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GCHFR gchfr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PTMVGDEQSD PELMQHLGAS KRRALGNNFY EYYVDDPPRI VLDKLERRGF. It is sometimes possible for the material contained within the vial of "GCHFR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.