Western Blot (WB)
(Host: RabbitTarget Name: GCC1Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human GCC1 Polyclonal Antibody | anti-GCC1 antibody
GCC1 Antibody - N-terminal region
Gene Names
GCC1; GCC1P; GCC88
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
GCC1; Polyclonal Antibody; GCC1 Antibody - N-terminal region; anti-GCC1 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 29% sucrose.
Sequence
Synthetic peptide located within the following region: LDTAASLTSTKGEFGVEDDRPARGPPPPKSEEASWSESGVSSSSGDGPFA
Sequence Length
775
Applicable Applications for anti-GCC1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GCC1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: GCC1Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GCC1Sample Tissue: Human Stomach Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-GCC1 antibody
The protein encoded by this gene is a peripheral membrane protein. It is sensitive to brefeldin A. This encoded protein contains a GRIP domain which is thought to be used in targeting. It may play a role in the organization of trans-Golgi network subcompartment involved with membrane transport.
Product Categories/Family for anti-GCC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85 kDa
NCBI Official Synonym Full Names
GRIP and coiled-coil domain containing 1
NCBI Official Symbol
GCC1
NCBI Official Synonym Symbols
GCC1P; GCC88
NCBI Protein Information
GRIP and coiled-coil domain-containing protein 1
UniProt Protein Name
GRIP and coiled-coil domain-containing protein 1
Protein Family
UniProt Gene Name
GCC1
UniProt Entry Name
GCC1_HUMAN
NCBI Description
The protein encoded by this gene is a peripheral membrane protein. It is sensitive to brefeldin A. This encoded protein contains a GRIP domain which is thought to be used in targeting. It may play a role in the organization of trans-Golgi network subcompartment involved with membrane transport. [provided by RefSeq, Jul 2008]
Uniprot Description
GCC1: Probably involved in maintaining Golgi structure.
Protein type: Vesicle
Chromosomal Location of Human Ortholog: 7q32.1
Cellular Component: Golgi membrane; Golgi apparatus; cytoplasm; plasma membrane
Molecular Function: protein binding
Biological Process: protein targeting to Golgi
Research Articles on GCC1
Similar Products
Product Notes
The GCC1 gcc1 (Catalog #AAA3220106) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GCC1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GCC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GCC1 gcc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LDTAASLTST KGEFGVEDDR PARGPPPPKS EEASWSESGV SSSSGDGPFA. It is sometimes possible for the material contained within the vial of "GCC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
