Rabbit anti-Human GCAT Polyclonal Antibody | anti-GCAT antibody

GCAT Antibody - middle region

Cat. Num. AAA3220591

• Gene Names: GCAT; KBL
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: GCAT; Polyclonal Antibody; GCAT Antibody - middle region; anti-GCAT antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: TGPGPLVSLLRQRARPYLFSNSLPPAVVGCASKALDLLMGSNTIVQSMAA
• Sequence Length: 167

• Applicable Applications for anti-GCAT antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GCAT
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GCATSample Tissue: Human Hela Whole CellAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-GCAT antibody

The degradation of L-threonine to glycine consists of a two-step biochemical pathway involving the enzymes L-threonine dehydrogenase and 2-amino-3-ketobutyrate coenzyme A ligase. L-Threonine is first converted into 2-amino-3-ketobutyrate by L-threonine dehydrogenase. This gene encodes the second enzyme in this pathway, which then catalyzes the reaction between 2-amino-3-ketobutyrate and coenzyme A to form glycine and acetyl-CoA. The encoded enzyme is considered a class II pyridoxal-phosphate-dependent aminotransferase. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 14.

Product Categories/Family for anti-GCAT antibody

Polyclonal

NCBI and Uniprot Product Information

• NCBI GI #: 284448556
• NCBI GeneID: 23464
• NCBI Accession #: NP_001165161.1
• NCBI GenBank Nucleotide #: NM_001171690.1
• UniProt Accession #: O75600
• Molecular Weight: 45 kDa
• NCBI Official Full Name: 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial isoform 1
• NCBI Official Synonym Full Names: glycine C-acetyltransferase
• NCBI Official Symbol: GCAT
• NCBI Official Synonym Symbols: KBL
• NCBI Protein Information: 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial
• UniProt Protein Name: 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial
• UniProt Gene Name: GCAT
• UniProt Synonym Gene Names: KBL; AKB ligase
• UniProt Entry Name: KBL_HUMAN

NCBI Description

The degradation of L-threonine to glycine consists of a two-step biochemical pathway involving the enzymes L-threonine dehydrogenase and 2-amino-3-ketobutyrate coenzyme A ligase. L-Threonine is first converted into 2-amino-3-ketobutyrate by L-threonine dehydrogenase. This gene encodes the second enzyme in this pathway, which then catalyzes the reaction between 2-amino-3-ketobutyrate and coenzyme A to form glycine and acetyl-CoA. The encoded enzyme is considered a class II pyridoxal-phosphate-dependent aminotransferase. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 14. [provided by RefSeq, Jan 2010]

Uniprot Description

GCAT: The degradation of L-threonine to glycine consists of a two-step biochemical pathway involving the enzymes L-threonine dehydrogenase and 2-amino-3-ketobutyrate coenzyme A ligase. L-Threonine is first converted into 2-amino-3-ketobutyrate by L-threonine dehydrogenase. This gene encodes the second enzyme in this pathway, which then catalyzes the reaction between 2-amino-3-ketobutyrate and coenzyme A to form glycine and acetyl-CoA. The encoded enzyme is considered a class II pyridoxal-phosphate-dependent aminotransferase. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 14. [provided by RefSeq, Jan 2010]

Protein type: Amino Acid Metabolism - glycine, serine and threonine; Mitochondrial; Transferase; EC 2.3.1.29

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: nucleoplasm; mitochondrion

Molecular Function: glycine C-acetyltransferase activity; pyridoxal phosphate binding

Biological Process: amino acid metabolic process; biosynthetic process; threonine catabolic process to pyruvate