Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (GATA2 rabbit polyclonal antibody. Western Blot analysis of GATA2 expression in human placenta.)

Rabbit anti-Human, Mouse GATA2 Polyclonal Antibody | anti-GATA2 antibody

GATA2 (Endothelial Transcription Factor GATA-2, GATA-binding Protein 2, MGC2306) (FITC)

Gene Names
GATA2; DCML; IMD21; NFE1B; MONOMAC
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GATA2; Polyclonal Antibody; GATA2 (Endothelial Transcription Factor GATA-2; GATA-binding Protein 2; MGC2306) (FITC); anti-GATA2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GATA2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Sequence Length
480
Applicable Applications for anti-GATA2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human GATA2, aa1-480 (NP_116027.2).
Immunogen Sequence
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(GATA2 rabbit polyclonal antibody. Western Blot analysis of GATA2 expression in human placenta.)

Western Blot (WB) (GATA2 rabbit polyclonal antibody. Western Blot analysis of GATA2 expression in human placenta.)

Western Blot (WB)

(GATA2 rabbit polyclonal antibody. Western Blot analysis of GATA2 expression in mouse brain.)

Western Blot (WB) (GATA2 rabbit polyclonal antibody. Western Blot analysis of GATA2 expression in mouse brain.)

Western Blot (WB)

(Western Blot analysis of GATA2 expression in transfected 293T cell line by GATA2 polyclonal antibody. Lane 1: GATA2 transfected lysate (50.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GATA2 expression in transfected 293T cell line by GATA2 polyclonal antibody. Lane 1: GATA2 transfected lysate (50.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GATA2 antibody
GATA2 is a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. This protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages.
Product Categories/Family for anti-GATA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
endothelial transcription factor GATA-2 isoform 1
NCBI Official Synonym Full Names
GATA binding protein 2
NCBI Official Symbol
GATA2
NCBI Official Synonym Symbols
DCML; IMD21; NFE1B; MONOMAC
NCBI Protein Information
endothelial transcription factor GATA-2
UniProt Protein Name
Endothelial transcription factor GATA-2
Protein Family
UniProt Gene Name
GATA2
UniProt Entry Name
GATA2_HUMAN

NCBI Description

This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]

Uniprot Description

GATA2: Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'. Endothelial cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 3q21.3

Cellular Component: nucleoplasm; protein complex

Molecular Function: protein binding; zinc ion binding; chromatin binding; transcription factor activity; transcription factor binding

Biological Process: embryonic placenta development; somatic stem cell maintenance; cell maturation; cell fate determination; negative regulation of transcription from RNA polymerase II promoter; cell differentiation in hindbrain; positive regulation of phagocytosis; positive regulation of megakaryocyte differentiation; central nervous system neuron development; inner ear morphogenesis; transcription, DNA-dependent; positive regulation of erythrocyte differentiation; regulation of histone acetylation; negative regulation of fat cell differentiation; phagocytosis; positive regulation of angiogenesis; negative regulation of macrophage differentiation; homeostasis of number of cells within a tissue; pituitary gland development; ventral spinal cord interneuron differentiation; commitment of a neuronal cell to a specific type of neuron in the forebrain; negative regulation of Notch signaling pathway; positive regulation of transcription from RNA polymerase II promoter; blood coagulation; urogenital system development

Disease: Lymphedema, Primary, With Myelodysplasia; Immunodeficiency 21; Myelodysplastic Syndrome

Research Articles on GATA2

Similar Products

Product Notes

The GATA2 gata2 (Catalog #AAA6379464) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GATA2 (Endothelial Transcription Factor GATA-2, GATA-binding Protein 2, MGC2306) (FITC) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's GATA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GATA2 gata2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GATA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.