Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GAS7Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that GAS7 is expressed in 721_B)

Rabbit anti-Human, Pig GAS7 Polyclonal Antibody | anti-GAS7 antibody

GAS7 antibody - N-terminal region

Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GAS7; Polyclonal Antibody; GAS7 antibody - N-terminal region; anti-GAS7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SGARCRTLYPFSGERHGQGLRFAAGELITLLQVPDGGWWEGEKEDGLRGW
Sequence Length
476
Applicable Applications for anti-GAS7 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GAS7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GAS7Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that GAS7 is expressed in 721_B)

Western Blot (WB) (Host: RabbitTarget Name: GAS7Sample Type: Human 721_BAntibody Dilution: 1.0ug/mlThere is BioGPS gene expression data showing that GAS7 is expressed in 721_B)

Western Blot (WB)

(Host: RabbitTarget Name: GAS7Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GAS7Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-GAS7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-GAS7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Related Product Information for anti-GAS7 antibody
This is a rabbit polyclonal antibody against GAS7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The growth arrest-specific 7 (GAS7) gene is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development.Growth arrest-specific 7 is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development. Several transcript variants encoding proteins which vary in the N-terminus have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
growth arrest-specific protein 7 isoform c
NCBI Official Synonym Full Names
growth arrest specific 7
NCBI Official Symbol
GAS7
NCBI Protein Information
growth arrest-specific protein 7
UniProt Protein Name
Growth arrest-specific protein 7
UniProt Gene Name
GAS7
UniProt Synonym Gene Names
KIAA0394; GAS-7
UniProt Entry Name
GAS7_HUMAN

NCBI Description

Growth arrest-specific 7 is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development. Several transcript variants encoding proteins which vary in the N-terminus have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

GAS7: May play a role in promoting maturation and morphological differentiation of cerebellar neurons. A chromosomal aberration involving GAS7 is found in acute myeloid leukemia. Translocation t(11;17)(q23;p13) with MLL/HRX. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; Actin-binding; Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: ruffle; cytoplasm; actin filament

Molecular Function: actin filament binding; transcription factor activity

Biological Process: regulation of cell shape; actin filament bundle formation; regulation of transcription, DNA-dependent; actin filament polymerization; cell cycle arrest; neurite morphogenesis

Research Articles on GAS7

Similar Products

Product Notes

The GAS7 gas7 (Catalog #AAA3208747) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GAS7 antibody - N-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's GAS7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GAS7 gas7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SGARCRTLYP FSGERHGQGL RFAAGELITL LQVPDGGWWE GEKEDGLRGW. It is sometimes possible for the material contained within the vial of "GAS7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.