Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: GAS6Sample Type: Breast TumorAntibody Dilution: 1.0ug/ml)

Rabbit GAS6 Polyclonal Antibody | anti-GAS6 antibody

GAS6 Antibody - Middle region

Gene Names
GAS6; AXSF; AXLLG
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
GAS6; Polyclonal Antibody; GAS6 Antibody - Middle region; anti-GAS6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALVDYHSTKKLKKQLVV
Sequence Length
624
Applicable Applications for anti-GAS6 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the Middle region of Human GAS6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: GAS6Sample Type: Breast TumorAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GAS6Sample Type: Breast TumorAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-GAS6 antibody
This is a rabbit polyclonal antibody against GAS6. It was validated on Western Blot

Target Description: This gene encodes a gamma-carboxyglutamic acid (Gla)-containing protein thought to be involved in the stimulation of cell proliferation. This gene is frequently overexpressed in many cancers and has been implicated as an adverse prognostic marker. Elevated protein levels are additionally associated with a variety of disease states, including venous thromboembolic disease, systemic lupus erythematosus, chronic renal failure, and preeclampsia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68 kDa
NCBI Official Full Name
growth arrest-specific protein 6
NCBI Official Synonym Full Names
growth arrest specific 6
NCBI Official Symbol
GAS6
NCBI Official Synonym Symbols
AXSF; AXLLG
NCBI Protein Information
growth arrest-specific protein 6
UniProt Protein Name
Growth arrest-specific protein 6
UniProt Gene Name
GAS6
UniProt Synonym Gene Names
AXLLG; GAS-6
UniProt Entry Name
GAS6_HUMAN

NCBI Description

This gene encodes a gamma-carboxyglutamic acid (Gla)-containing protein thought to be involved in the stimulation of cell proliferation. This gene is frequently overexpressed in many cancers and has been implicated as an adverse prognostic marker. Elevated protein levels are additionally associated with a variety of disease states, including venous thromboembolic disease, systemic lupus erythematosus, chronic renal failure, and preeclampsia. [provided by RefSeq, Aug 2014]

Uniprot Description

GAS6: Ligand for tyrosine-protein kinase receptors AXL, TYRO3 and MER whose signaling is implicated in cell growth and survival, cell adhesion and cell migration. GAS6/AXL signaling plays a role in various processes such as endothelial cell survival during acidification by preventing apoptosis, optimal cytokine signaling during human natural killer cell development, hepatic regeneration, gonadotropin-releasing hormone neuron survival and migration, platelet activation, or regulation of thrombotic responses. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Ligand, receptor tyrosine kinase; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 13q34

Cellular Component: extracellular space; endoplasmic reticulum lumen; Golgi lumen; cytoplasm; extracellular region

Molecular Function: voltage-gated calcium channel activity; protein binding; phosphatidylserine binding; caspase inhibitor activity; protein tyrosine kinase activator activity; calcium ion binding; receptor tyrosine kinase binding; receptor agonist activity; molecular adaptor activity; receptor binding

Biological Process: proteolysis; enzyme linked receptor protein signaling pathway; protein amino acid phosphorylation; positive regulation of fibroblast proliferation; viral envelope fusion with host membrane; negative regulation of protein import into nucleus, translocation; regulation of growth; positive regulation of phagocytosis; negative regulation of interleukin-6 production; cell cycle arrest; cell adhesion; positive regulation of TOR signaling pathway; platelet activation; organ regeneration; activation of protein kinase B; negative regulation of transcription factor activity; cellular response to starvation; peptidyl-glutamic acid carboxylation; negative regulation of transcription, DNA-dependent; negative regulation of interleukin-1 secretion; leukocyte migration; negative regulation of apoptosis; entry of virus into host cell; neuron migration; negative regulation of caspase activity; signal transduction; positive regulation of protein export from nucleus; positive regulation of natural killer cell differentiation; platelet degranulation; positive regulation of glomerular filtration; negative regulation of interferon-gamma production; protein kinase B signaling cascade; virion attachment, binding of host cell surface receptor; cell migration; negative regulation of tumor necrosis factor production; viral genome replication; post-translational protein modification; positive regulation of peptidyl-serine phosphorylation; cell-substrate adhesion; phagocytosis; cell proliferation; positive regulation of protein kinase B signaling cascade; peptidyl-serine phosphorylation; cellular protein metabolic process; positive regulation of protein kinase activity; positive regulation of protein amino acid phosphorylation; blood coagulation; positive regulation of cytokine and chemokine mediated signaling pathway; apoptotic cell clearance

Research Articles on GAS6

Similar Products

Product Notes

The GAS6 gas6 (Catalog #AAA3215034) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GAS6 Antibody - Middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GAS6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GAS6 gas6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WEVEVVAHIR PAADTGVLFA LWAPDLRAVP LSVALVDYHS TKKLKKQLVV. It is sometimes possible for the material contained within the vial of "GAS6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.