Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GALNT13 expression in transfected 293T cell line by GALNT13 polyclonal antibody. Lane 1: GALNT13 transfected lysate (61.16kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human GALNT13 Polyclonal Antibody | anti-GALNT13 antibody

GALNT13 (KIAA1918, Polypeptide N-acetylgalactosaminyltransferase 13, Polypeptide GalNAc Transferase 13, Protein-UDP Acetylgalactosaminyltransferase 13, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13, FLJ16031, FLJ41157, H_NH0187G20.1, MGC1194

Gene Names
GALNT13; GalNAc-T13; H_NH0187G20.1; WUGSC:H_NH0187G20.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
GALNT13; Polyclonal Antibody; GALNT13 (KIAA1918; Polypeptide N-acetylgalactosaminyltransferase 13; Polypeptide GalNAc Transferase 13; Protein-UDP Acetylgalactosaminyltransferase 13; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13; FLJ16031; FLJ41157; H_NH0187G20.1; MGC1194; Anti -GALNT13 (KIAA1918; anti-GALNT13 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GALNT13.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MRRSVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMTLGT
Applicable Applications for anti-GALNT13 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human GALNT13, aa1-556 (NP_443149).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GALNT13 expression in transfected 293T cell line by GALNT13 polyclonal antibody. Lane 1: GALNT13 transfected lysate (61.16kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GALNT13 expression in transfected 293T cell line by GALNT13 polyclonal antibody. Lane 1: GALNT13 transfected lysate (61.16kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GALNT13 antibody
Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Has a much stronger activity than GALNT1 to transfer GalNAc to mucin peptides, such as Muc5Ac and Muc7. Able to glycosylate SDC3. May be responsible for the synthesis of Tn antigen in neuronal cells.
Product Categories/Family for anti-GALNT13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
64,051 Da
NCBI Official Full Name
GALNT13 protein
NCBI Official Synonym Full Names
UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 13 (GalNAc-T13)
NCBI Official Symbol
GALNT13
NCBI Official Synonym Symbols
GalNAc-T13; H_NH0187G20.1; WUGSC:H_NH0187G20.1
NCBI Protein Information
polypeptide N-acetylgalactosaminyltransferase 13; pp-GaNTase 13; GalNAc transferase 13; polypeptide GalNAc transferase 13; protein-UDP acetylgalactosaminyltransferase 13; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13
UniProt Protein Name
Polypeptide N-acetylgalactosaminyltransferase 13
UniProt Gene Name
GALNT13
UniProt Synonym Gene Names
KIAA1918; GalNAc-T13
UniProt Entry Name
GLT13_HUMAN

NCBI Description

The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT; EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins (see MUC3A, MIM 158371) by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.[supplied by OMIM, Apr 2004]

Uniprot Description

GALNT13: Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D- galactosamine residue to a serine or threonine residue on the protein receptor. Has a much stronger activity than GALNT1 to transfer GalNAc to mucin peptides, such as Muc5Ac and Muc7. Able to glycosylate SDC3. May be responsible for the synthesis of Tn antigen in neuronal cells. Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Glycan Metabolism - O-glycan biosynthesis; Transferase; EC 2.4.1.41

Chromosomal Location of Human Ortholog: 2q24.1

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: metal ion binding; polypeptide N-acetylgalactosaminyltransferase activity; carbohydrate binding

Biological Process: protein amino acid O-linked glycosylation; cellular protein metabolic process; O-glycan processing; post-translational protein modification

Research Articles on GALNT13

Similar Products

Product Notes

The GALNT13 galnt13 (Catalog #AAA644477) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GALNT13 (KIAA1918, Polypeptide N-acetylgalactosaminyltransferase 13, Polypeptide GalNAc Transferase 13, Protein-UDP Acetylgalactosaminyltransferase 13, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13, FLJ16031, FLJ41157, H_NH0187G20.1, MGC1194 reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GALNT13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the GALNT13 galnt13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRRSVYCKVV LATSLMWVLV DVFLLLYFSE CNKCDDKKER SLLPALRAVI SRNQEGPGEM GKAVLIPKDD QEKMKELFKI NQFNLMASDL IALNRSLPDV RLEGCKTKVY PDELPNTSVV IVFHNEAWST LLRTVYSVIN RSPHYLLSEV ILVDDASERD FLKLTLENYV KNLEVPVKII RMEERSGLIR ARLRGAAASK GQVITFLDAH CECTLGWLEP LLARIKEDRK TVVCPIIDVI SDDTFEYMAG SDMTYGGFNW KLNFRWYPVP QREMDRRKGD RTLPVRTPTM AGGLFSIDRN YFEEIGTYDA GMDIWGGENL EMSFRIWQCG GSLEIVTCSH VGHVFRKATP YTFPGGTGHV INKNNRRLAE VWMDEFKDFF YIISPGVVKV DYGDVSVRKT LRENLKCKPF SWYLENIYPD SQIPRRYYSL GEIRNVETNQ CLDNMGRKEN EKVGIFNCHG MGGNQVFSYT ADKEIRTDDL CLDVSRLNGP VIMLKCHHMR GNQLWEYDAE RLTLRHVNSN QCLDEPSEED KMVPTMQDCS GSRSQQWLLR NMTLGT. It is sometimes possible for the material contained within the vial of "GALNT13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.