Western Blot (WB)
(Anti- Galectin 8 Picoband antibody, MBS178158, Western blottingAll lanes: Anti Galectin 8 (MBS178158) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: A431 Whole Cell Lysate at 40ugPredicted bind size: 36KDObserved bind size: 50KD )
anti-Human, Rat Galectin 8 Polyclonal Antibody | anti-LGALS8 antibody
Anti-Galectin 8 Antibody
Gene Names
LGALS8; Gal-8; PCTA1; PCTA-1; Po66-CBP
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Galectin 8; Polyclonal Antibody; Anti-Galectin 8 Antibody; Galectin-8; Gal 8; Gal-8; Gal8; galectin-8g; Lectin galactoside binding soluble 8; LEG8_HUMAN; LGAL S8; Lgals8; PCTA 1; PCTA-1; PCTA1; Po66 carbohydrate binding protein; Po66 carbohydrate-binding protein; Po66 CBP; Po66-CBP; Prostate carcinoma tumor antigen 1; lectin; galactoside-binding; soluble; 8; anti-LGALS8 antibody
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
359
Applicable Applications for anti-LGALS8 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Galectin 8 (286-317aa HSLEYKHRFKELSSIDTLEINGDIHLLEVRSW), different from the related mouse and rat sequences by six amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Anti- Galectin 8 Picoband antibody, MBS178158, Western blottingAll lanes: Anti Galectin 8 (MBS178158) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: A431 Whole Cell Lysate at 40ugPredicted bind size: 36KDObserved bind size: 50KD )
Western Blot (WB)
(Anti- Galectin 8 Picoband antibody, MBS178158, Western blottingAll lanes: Anti Galectin 8 (MBS178158) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Human Placenta Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugLane 5: A431 Whole Cell Lysate at 40ugPredicted bind size: 36KDObserved bind size: 50KD )
Related Product Information for anti-LGALS8 antibody
Description: Rabbit IgG polyclonal antibody for Galectin-8(LGALS8) detection. Tested with WB in Human;Rat.
Background: Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene. This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.
Background: Galectin-8 is a protein of the galectin family that in humans is encoded by the LGALS8 gene. This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.
References
1. "Entrez Gene: LGALS8 lectin, galactoside-binding, soluble, 8 (galectin 8)". 2. Hadari YR, Paz K, Dekel R, Mestrovic T, Accili D, Zick Y (Mar 1995). "Galectin-8. A new rat lectin, related to galectin-4". J Biol Chem 270 (7): 3447-53. 3. Su ZZ, Lin J, Shen R, Fisher PE, Goldstein NI, Fisher PB (Aug 1996). "Surface-epitope masking and expression cloning identifies the human prostate carcinoma tumor antigen gene PCTA-1 a member of the galectin gene family". Proc Natl Acad Sci U S A 93 (14): 7252-7.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40,397 Da
NCBI Official Full Name
galectin-8 isoform a
NCBI Official Synonym Full Names
galectin 8
NCBI Official Symbol
LGALS8
NCBI Official Synonym Symbols
Gal-8; PCTA1; PCTA-1; Po66-CBP
NCBI Protein Information
galectin-8
UniProt Protein Name
Galectin-8
Protein Family
UniProt Gene Name
LGALS8
UniProt Synonym Gene Names
Gal-8; Po66-CBP; PCTA-1
UniProt Entry Name
LEG8_HUMAN
NCBI Description
This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Uniprot Description
galectin-8: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Cell adhesion
Chromosomal Location of Human Ortholog: 1q43
Cellular Component: cytosol; extracellular space; membrane
Molecular Function: carbohydrate binding; protein binding
Research Articles on LGALS8
Similar Products
Product Notes
The LGALS8 lgals8 (Catalog #AAA178158) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Galectin 8 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Galectin 8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the LGALS8 lgals8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Galectin 8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
