Western Blot (WB)
(Western Blot analysis of GAGE1 expression in transfected 293T cell line by GAGE1 polyclonal antibody. Lane 1: GAGE1 transfected lysate (15.29kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human GAGE1 Polyclonal Antibody | anti-GAGE1 antibody
GAGE1 (G Antigen 1, GAGE-1, Antigen MZ2-F, Cancer/Testis Antigen 4.1, CT4.1)
Gene Names
GAGE1; CT4.1; GAGE-1
Reactivity
Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
GAGE1; Polyclonal Antibody; GAGE1 (G Antigen 1; GAGE-1; Antigen MZ2-F; Cancer/Testis Antigen 4.1; CT4.1); Anti -GAGE1 (G Antigen 1; anti-GAGE1 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human GAGE1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQTGILWLLMNNCFLNLSPRKP
Applicable Applications for anti-GAGE1 antibody
Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Full length human GAGE1, aa1-139 (NP_001459.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of GAGE1 expression in transfected 293T cell line by GAGE1 polyclonal antibody. Lane 1: GAGE1 transfected lysate (15.29kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of GAGE1 expression in transfected 293T cell line by GAGE1 polyclonal antibody. Lane 1: GAGE1 transfected lysate (15.29kD). Lane 2: Non-transfected lysate.)
Immunohistochemistry (IHC)
(Immunoperoxidase of purified antibody to GAGE1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of purified antibody to GAGE1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)
Related Product Information for anti-GAGE1 antibody
The GAGE1 gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The GAGE1 cDNA contains a 143-bp insertion, located in the coding sequence near the termination codon, that is absent from the other cDNAs. Autologous cytolytic T lymphocytes recognise the antigenic peptide YRPRPRRY, which is also encoded by several other family members. Nothing is presently known about the function of this protein. An alternatively spliced transcript variant has been found for this gene.
Product Categories/Family for anti-GAGE1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,610 Da
NCBI Official Full Name
G antigen 1
NCBI Official Synonym Full Names
G antigen 1
NCBI Official Symbol
GAGE1
NCBI Official Synonym Symbols
CT4.1; GAGE-1
NCBI Protein Information
G antigen 1; MZ2-F antigen; cancer/testis antigen 4.1; cancer/testis antigen family 4, member 1
UniProt Protein Name
G antigen 1
Protein Family
UniProt Gene Name
GAGE1
UniProt Synonym Gene Names
GAGE-1; CT4.1
UniProt Entry Name
GAGE1_HUMAN
NCBI Description
This gene belongs to a family of genes that are expressed in a variety of tumors but not in normal tissues, except for the testis. The sequences of the family members are highly related but differ by scattered nucleotide substitutions. The antigenic peptide YRPRPRRY, which is also encoded by several other family members, is recognized by autologous cytolytic T lymphocytes. Nothing is presently known about the function of this protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010]
Uniprot Description
GAGE1: Antigen, recognized on melanoma by autologous cytolytic T-lymphocytes. Completely silent in normal adult tissues, except testis. Belongs to the GAGE family.
Protein type: Cancer Testis Antigen (CTA)
Chromosomal Location of Human Ortholog: Xp11.23
Biological Process: cellular defense response
Research Articles on GAGE1
Similar Products
Product Notes
The GAGE1 gage1 (Catalog #AAA6009107) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GAGE1 (G Antigen 1, GAGE-1, Antigen MZ2-F, Cancer/Testis Antigen 4.1, CT4.1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GAGE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the GAGE1 gage1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSWRGRSTYY WPRPRRYVQP PEMIGPMRPE QFSDEVEPAT PEEGEPATQR QDPAAAQEGE DEGASAGQGP KPEADSQEQG HPQTGCECED GPDGQEMDPP NPEEVKTPEE EMRSHYVAQT GILWLLMNNC FLNLSPRKP. It is sometimes possible for the material contained within the vial of "GAGE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
