Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-GADD45A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human heart)

Rabbit GADD45A Polyclonal Antibody | anti-GADD45A antibody

GADD45A antibody - C-terminal region

Gene Names
GADD45A; DDIT1; GADD45
Reactivity
Cow, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GADD45A; Polyclonal Antibody; GADD45A antibody - C-terminal region; anti-GADD45A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPA
Sequence Length
165
Applicable Applications for anti-GADD45A antibody
Western Blot (WB)
Homology
Cow: 100%; Horse: 79%; Human: 100%; Pig: 93%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human GADD45A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-GADD45A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-GADD45A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human heart)
Related Product Information for anti-GADD45A antibody
This is a rabbit polyclonal antibody against GADD45A. It was validated on Western Blot

Target Description: GADD45A responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of GADD45A gene is mediated by both p53-dependent and -independent mechanisms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
growth arrest and DNA damage-inducible protein GADD45 alpha isoform 1
NCBI Official Synonym Full Names
growth arrest and DNA damage inducible alpha
NCBI Official Symbol
GADD45A
NCBI Official Synonym Symbols
DDIT1; GADD45
NCBI Protein Information
growth arrest and DNA damage-inducible protein GADD45 alpha
UniProt Protein Name
Growth arrest and DNA damage-inducible protein GADD45 alpha
UniProt Gene Name
GADD45A
UniProt Synonym Gene Names
DDIT1; GADD45; DDIT-1
UniProt Entry Name
GA45A_HUMAN

NCBI Description

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Dec 2010]

Uniprot Description

GADD45A: In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity. Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. Interacts with MAPK14. Interacts with GADD45GIP1. Interacts with PCNA. By UV irradiation, X-rays, growth arrest and alkylating agents. The induction is mediate by some kinase(s) other than PKC. Belongs to the GADD45 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; DNA repair, damage; Nuclear receptor co-regulator; Cell cycle regulation

Chromosomal Location of Human Ortholog: 1p31.2

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding

Biological Process: positive regulation of apoptosis; apoptosis; centrosome cycle; activation of MAPKKK activity; DNA damage response, signal transduction; negative regulation of protein kinase activity; positive regulation of JNK cascade; regulation of cyclin-dependent protein kinase activity; DNA repair; cell cycle arrest

Research Articles on GADD45A

Similar Products

Product Notes

The GADD45A gadd45a (Catalog #AAA3214691) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GADD45A antibody - C-terminal region reacts with Cow, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's GADD45A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the GADD45A gadd45a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRVSNPGRLA ELLLLETDAG PAASEGAEQP PDLHCVLVTN PHSSQWKDPA. It is sometimes possible for the material contained within the vial of "GADD45A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.