Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of GADD45A expression in MCF-7 whole cell lysates (lane 1). GADD45A at 19KD was detected using rabbit anti-GADD45A Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit GADD45A Polyclonal Antibody | anti-GADD45A antibody

Anti-GADD45A Antibody

Gene Names
GADD45A; DDIT1; GADD45
Reactivity
Human
No cross reactivity with other proteins.
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
GADD45A; Polyclonal Antibody; Anti-GADD45A Antibody; DDIT1; DDIT-1; GADD45; GA45A; P24522; Growth arrest and DNA damage-inducible protein GADD45 alpha; growth arrest and DNA-damage-inducible; alpha; anti-GADD45A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
131
Applicable Applications for anti-GADD45A antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5mug/ml; Tested Species: Human
Tested Species:In-house tested species with positive results.
Other applications have not been tested.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human GADD45A (125-165aa VLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLP ER), identical to the related mouse and rat sequences.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of GADD45A expression in MCF-7 whole cell lysates (lane 1). GADD45A at 19KD was detected using rabbit anti-GADD45A Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of GADD45A expression in MCF-7 whole cell lysates (lane 1). GADD45A at 19KD was detected using rabbit anti-GADD45A Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-GADD45A antibody
Rabbit IgG polyclonal antibody for Growth arrest and DNA damage-inducible protein GADD45 alpha (GADD45A) detection.
Background: Growth arrest and DNA-damage-inducible protein GADD45 alpha (GADD45A) is a protein that in humans is encoded by the GADD45A gene. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. It is located on 1p34-p12. Sequence analysis of human and hamster cDNA clones demonstrated that the gene has been highly conserved and encodes a novel 165-amino acid polypeptide. Northern blot analysis detected moderate expression of a 1.4-kb GADD45A transcript in heart, skeletal muscle, and kidney, with little or no expression in brain, placenta, lung, liver, and pancreas. In addition, Gadd45a promotes epigenetic gene activation by repair-mediated DNA demethylation.
References
1. Barreto, G., Schafer, A. Marhold, J., Stach, D., Swaminathan, S. K., Handa, V., Doderlein, G., Maltry, N., Wu, W., Lyko, F., Niehrs, C.Gadd45a promotes epigenetic gene activation by repair-mediated DNA demethylation.Nature445: 671-675, 2007.
2. Papathanasiou MA, Kerr NC, Robbins JH, McBride OW, Alamo I Jr, Barrett SF, Hickson ID, Fornace AJ Jr (Mar 1991). "Induction by ionizing radiation of the gadd45 gene in cultured human cells: lack of mediation by protein kinase C". Mol Cell Biol 11 (2): 1009-16.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14,622 Da
NCBI Official Full Name
growth arrest and DNA damage-inducible protein GADD45 alpha isoform 2
NCBI Official Synonym Full Names
growth arrest and DNA damage inducible alpha
NCBI Official Symbol
GADD45A
NCBI Official Synonym Symbols
DDIT1; GADD45
NCBI Protein Information
growth arrest and DNA damage-inducible protein GADD45 alpha
UniProt Protein Name
Growth arrest and DNA damage-inducible protein GADD45 alpha
UniProt Gene Name
GADD45A
UniProt Synonym Gene Names
DDIT1; GADD45; DDIT-1
UniProt Entry Name
GA45A_HUMAN

NCBI Description

This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The DNA damage-induced transcription of this gene is mediated by both p53-dependent and -independent mechanisms. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Dec 2010]

Uniprot Description

GADD45A: In T-cells, functions as a regulator of p38 MAPKs by inhibiting p88 phosphorylation and activity. Might affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. Interacts with MAPK14. Interacts with GADD45GIP1. Interacts with PCNA. By UV irradiation, X-rays, growth arrest and alkylating agents. The induction is mediate by some kinase(s) other than PKC. Belongs to the GADD45 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Apoptosis; Cell cycle regulation; DNA repair, damage; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 1p31.2

Cellular Component: cytoplasm; nucleoplasm; nucleus

Molecular Function: protein binding

Biological Process: activation of MAPKKK activity; apoptosis; cell cycle arrest; DNA damage response, signal transduction; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; DNA repair; positive regulation of apoptosis; positive regulation of JNK cascade; regulation of cyclin-dependent protein kinase activity

Research Articles on GADD45A

Similar Products

Product Notes

The GADD45A gadd45a (Catalog #AAA178445) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-GADD45A Antibody reacts with Human No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's GADD45A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5mug/ml; Tested Species: Human Tested Species:In-house tested species with positive results. Other applications have not been tested. Researchers should empirically determine the suitability of the GADD45A gadd45a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GADD45A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.