Rabbit anti-Mouse, Rat GABRA2 Polyclonal Antibody | anti-GABRA2 antibody
GABRA2 Polyclonal Antibody
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
GABRA2; Polyclonal Antibody; GABRA2 Polyclonal Antibody; anti-GABRA2 antibody
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
ARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGWAWDGKSVVNDKKKEKASVMIQNNAYAVAVANYAPNLSKDPVLSTISKSATTPEPNKKP
Sequence Length
451
Applicable Applications for anti-GABRA2 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
A synthetic peptide of human GABRA2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-GABRA2 antibody
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-GABRA2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
51kDa/52kDa
NCBI Official Full Name
gamma-aminobutyric acid receptor subunit alpha-2 isoform a
NCBI Official Synonym Full Names
gamma-aminobutyric acid type A receptor alpha2 subunit
NCBI Official Symbol
GABRA2
NCBI Protein Information
gamma-aminobutyric acid receptor subunit alpha-2
UniProt Protein Name
Gamma-aminobutyric acid receptor subunit alpha-2
Protein Family
UniProt Gene Name
GABRA2
NCBI Description
GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. At least 16 distinct subunits of GABA-A receptors have been identified. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]
Uniprot Description
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
Research Articles on GABRA2
Similar Products
Product Notes
The GABRA2 gabra2 (Catalog #AAA9134195) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GABRA2 Polyclonal Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GABRA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the GABRA2 gabra2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ARNSLPKVAY ATAMDWFIAV CYAFVFSALI EFATVNYFTK RGWAWDGKSV VNDKKKEKAS VMIQNNAYAV AVANYAPNLS KDPVLSTISK SATTPEPNKK P. It is sometimes possible for the material contained within the vial of "GABRA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
