Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-GABARAP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit GABARAP Polyclonal Antibody | anti-GABARAP antibody

GABARAP antibody - N-terminal region

Gene Names
GABARAP; MM46; ATG8A; GABARAP-a
Reactivity
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity: Human
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
GABARAP; Polyclonal Antibody; GABARAP antibody - N-terminal region; anti-GABARAP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Tested Species Reactivity: Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5- 1mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL
Sequence Length
117
Applicable Applications for anti-GABARAP antibody
Western Blot (WB), Immunohistochemistry (IHC)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human GABARAP
Protein Interactions
MUL1; UBC; SQSTM1; TAX1BP1; NBR1; ATG101; ATG13; SRPK2; SRPK1; MAPK15; MLH1; BNIP3L; KATNB1; RB1CC1; ULK2; ULK1; OPTN; TBC1D25; DVL2; ATG7; FKBP4; MAP1LC3C; DYX1C1; NCOA7; MAP1LC3B; TBC1D15; ATG3; PI4K2A; ANKFY1; GABARAPL1; ATG4B; FNBP1; GABARAPL2; TECPR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-GABARAP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-GABARAP AntibodyFormalin Fixed Paraffin Embedded Tissue: Human heart TissueObserved Staining: CytoplasmicPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(Sample Type: Manduca sextaAutophagy is induced by starvationSample: Newborn M. Sexta larvaeLanes: Newborn larvae were treated for 0,0.5,1,2,3,4, and 5 hProtein Loaded: 100 ug per laneSubmitted by: Dra. Helena Porta Ducoing, Instituto de Biotechnologia, UNAM )

Western Blot (WB) (Sample Type: Manduca sextaAutophagy is induced by starvationSample: Newborn M. Sexta larvaeLanes: Newborn larvae were treated for 0,0.5,1,2,3,4, and 5 hProtein Loaded: 100 ug per laneSubmitted by: Dra. Helena Porta Ducoing, Instituto de Biotechnologia, UNAM )

Western Blot (WB)

(Host: RabbitTarget Name: GABARAPSample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: GABARAPSample Tissue: Human OVCAR-3 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-GABARAP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysateGABARAP is supported by BioGPS gene expression data to be expressed in HT1080)

Western Blot (WB) (WB Suggested Anti-GABARAP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HT1080 cell lysateGABARAP is supported by BioGPS gene expression data to be expressed in HT1080)
Related Product Information for anti-GABARAP antibody
This is a rabbit polyclonal antibody against GABARAP. It was validated on Western Blot

Target Description: Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. GABA(A) receptor-associated protein (GABARAP) is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.
Product Categories/Family for anti-GABARAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
14kDa
NCBI Official Full Name
gamma-aminobutyric acid receptor-associated protein
NCBI Official Synonym Full Names
GABA type A receptor-associated protein
NCBI Official Symbol
GABARAP
NCBI Official Synonym Symbols
MM46; ATG8A; GABARAP-a
NCBI Protein Information
gamma-aminobutyric acid receptor-associated protein
UniProt Protein Name
Gamma-aminobutyric acid receptor-associated protein
UniProt Gene Name
GABARAP
UniProt Synonym Gene Names
FLC3B
UniProt Entry Name
GBRAP_HUMAN

NCBI Description

Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. [provided by RefSeq, Jul 2008]

Uniprot Description

GABARAP: is a ubiquitin-like protein that is a constituent of the ATG8-conjugation system, one of two evolutionarily conserved phosphatidylethanolamine conjugation systems necessary for the formation of the autophagosome. The human ATG8 system includes seven ubiquitin-like light chain proteins (LCPs) that are homologs of yeast LC3: MAP1LC3A, -B, -C, GABARAP, GABARAPL1, -2, and -3. Pro-LCPs are cleaved by ATG4B to expose a C-terminal glycine residue, the cytosolic LCP-I form. The exposed C-terminus is conjugated to the head group amine of phosphatidylethanolamine (PE) through an amide bond by a sequence of ubiquitination-like reactions that involves an E1 (ATG7), an E2 (ATG3), and an E3 (a complex including ATG5, ATG12, and ATG16L). The PE-congugated form (LCP-II) is tightly associated with the autophagosomal membrane. The LCP-II forms can also be delipidated by the ATG4 proteases: most of the LCPs are delipidated and liberated from the membrane before autophagosomes fuse with lysosomes. May play a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Belongs to the MAP1 LC3 family. Interacts with GPHN and NSF. Interacts with GABRG2, beta-tubulin and ULK1.

Protein type: Autophagy; Ubiquitin-like modifier; Adaptor/scaffold; Microtubule-binding; Vesicle

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: microtubule; smooth endoplasmic reticulum; lysosome; autophagic vacuole; cytosol; actin cytoskeleton; Golgi membrane; microtubule associated complex; extrinsic to membrane; perinuclear region of cytoplasm; plasma membrane; axoneme; cytoplasmic vesicle

Molecular Function: protein binding; microtubule binding; beta-tubulin binding; GABA receptor binding

Biological Process: synaptic transmission; induction of apoptosis via death domain receptors; mitochondrion degradation; microtubule cytoskeleton organization and biogenesis; protein targeting; autophagic vacuole formation

Research Articles on GABARAP

Similar Products

Product Notes

The GABARAP gabarap (Catalog #AAA3210282) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GABARAP antibody - N-terminal region reacts with Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish Tested Species Reactivity: Human and may cross-react with other species as described in the data sheet. AAA Biotech's GABARAP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC). Researchers should empirically determine the suitability of the GABARAP gabarap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IRKKYPDRVP VIVEKAPKAR IGDLDKKKYL VPSDLTVGQF YFLIRKRIHL. It is sometimes possible for the material contained within the vial of "GABARAP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.