Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FZD5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateFZD5 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit FZD5 Polyclonal Antibody | anti-FZD5 antibody

FZD5 antibody - C-terminal region

Gene Names
FZD5; HFZ5; C2orf31
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FZD5; Polyclonal Antibody; FZD5 antibody - C-terminal region; anti-FZD5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH
Sequence Length
585
Applicable Applications for anti-FZD5 antibody
Western Blot (WB)
Homology
Cow: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 86%; Rabbit: 87%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FZD5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FZD5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateFZD5 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Western Blot (WB) (WB Suggested Anti-FZD5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysateFZD5 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Related Product Information for anti-FZD5 antibody
This is a rabbit polyclonal antibody against FZD5. It was validated on Western Blot

Target Description: Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
frizzled-5
NCBI Official Synonym Full Names
frizzled class receptor 5
NCBI Official Symbol
FZD5
NCBI Official Synonym Symbols
HFZ5; C2orf31
NCBI Protein Information
frizzled-5
UniProt Protein Name
Frizzled-5
Protein Family
UniProt Gene Name
FZD5
UniProt Synonym Gene Names
C2orf31; Fz-5; hFz5

NCBI Description

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand. [provided by RefSeq, Jul 2008]

Uniprot Description

Receptor for Wnt proteins (PubMed:9054360, PubMed:10097073, PubMed:20530549). Can activate WNT2, WNT10B, WNT5A, but not WNT2B or WNT4 (in vitro); the in vivo situation may be different since not all of these are known to be coexpressed (). In neurons, activation of WNT7A promotes formation of synapses (PubMed:20530549). Functions in the canonical Wnt/beta-catenin signaling pathway. The canonical Wnt/beta-catenin signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes (). A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (Probable). Plays a role in yolk sac angiogenesis and in placental vascularization ().

Research Articles on FZD5

Similar Products

Product Notes

The FZD5 fzd5 (Catalog #AAA3205733) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FZD5 antibody - C-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FZD5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FZD5 fzd5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRCCCRPRRG HKSGGAMAAG DYPEASAALT GRTGPPGPAA TYHKQVSLSH. It is sometimes possible for the material contained within the vial of "FZD5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.