Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: MouseTarget Name: FYNSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Rabbit FYN Polyclonal Antibody | anti-FYN antibody

FYN antibody - middle region

Gene Names
FYN; SLK; SYN; p59-FYN
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FYN; Polyclonal Antibody; FYN antibody - middle region; anti-FYN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGEN
Sequence Length
537
Applicable Applications for anti-FYN antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FYN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: MouseTarget Name: FYNSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: MouseTarget Name: FYNSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: FYNSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FYNSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-FYN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)

Western Blot (WB) (WB Suggested Anti-FYN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: COLO205 cell lysate)
Related Product Information for anti-FYN antibody
This is a rabbit polyclonal antibody against FYN. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.
Product Categories/Family for anti-FYN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
tyrosine-protein kinase Fyn isoform a
NCBI Official Synonym Full Names
FYN proto-oncogene, Src family tyrosine kinase
NCBI Official Symbol
FYN
NCBI Official Synonym Symbols
SLK; SYN; p59-FYN
NCBI Protein Information
tyrosine-protein kinase Fyn
UniProt Protein Name
Tyrosine-protein kinase Fyn
Protein Family
UniProt Gene Name
FYN
UniProt Synonym Gene Names
SLK
UniProt Entry Name
FYN_HUMAN

NCBI Description

This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist. [provided by RefSeq, Jul 2008]

Uniprot Description

Fyn: a tyrosine kinase of the Src family. Implicated in the control of cell growth. Plays a role in the regulation of intracellular calcium levels. Required in brain development and mature brain function with important roles in the regulation of axon growth, axon guidance, and neurite extension. Blocks axon outgrowth and attraction induced by NTN1 by phosphorylating its receptor DDC. Associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Three alternatively spliced isoforms have been described. Isoform 2 shows a greater ability to mobilize cytoplasmic calcium than isoform 1. Induced expression aids in cellular transformation and xenograft metastasis. In squamous cell carcinoma, Fyn transduces signals from EGFR and Src and is required for cell migration and invasiveness. Activity linked to migration in a murine melanoma model. Appears to block late stage development of neuroblastoma. Mouse knockout deficient in kindling response, a model for human epilepsy.

Protein type: Protein kinase, TK; Oncoprotein; Protein kinase, tyrosine (non-receptor); EC 2.7.10.2; Kinase, protein; TK group; Src family

Chromosomal Location of Human Ortholog: 6q21

Cellular Component: extrinsic to internal side of plasma membrane; mitochondrion; postsynaptic density; plasma membrane; actin filament; cytosol; nucleus; endosome; lipid raft

Molecular Function: tubulin binding; CD8 receptor binding; ephrin receptor binding; metal ion binding; non-membrane spanning protein tyrosine kinase activity; protein binding; G-protein-coupled receptor binding; peptide hormone receptor binding; protein-tyrosine kinase activity; T cell receptor binding; phosphoinositide 3-kinase binding; glycoprotein binding; CD4 receptor binding; ATP binding

Biological Process: axon guidance; central nervous system development; viral reproduction; T cell activation; nerve growth factor receptor signaling pathway; neuron migration; protein amino acid phosphorylation; T cell receptor signaling pathway; regulation of apoptosis; regulation of cell shape; calcium ion transport; forebrain development; ephrin receptor signaling pathway; feeding behavior; negative regulation of neuron apoptosis; cell differentiation; epidermal growth factor receptor signaling pathway; response to drug; platelet activation; cell migration; fibroblast growth factor receptor signaling pathway; positive regulation of I-kappaB kinase/NF-kappaB cascade; phosphoinositide-mediated signaling; dendrite morphogenesis; activated T cell proliferation; learning; regulation of defense response to virus by virus; regulation of cell proliferation; positive regulation of phosphoinositide 3-kinase cascade; detection of mechanical stimulus involved in sensory perception of pain; response to ethanol; T cell costimulation; innate immune response; negative regulation of protein catabolic process; blood coagulation; vascular endothelial growth factor receptor signaling pathway; leukocyte migration; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on FYN

Similar Products

Product Notes

The FYN fyn (Catalog #AAA3212291) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FYN antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FYN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FYN fyn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CPQDCPISLH ELMIHCWKKD PEERPTFEYL QSFLEDYFTA TEPQYQPGEN. It is sometimes possible for the material contained within the vial of "FYN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.