Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FUT1 expression in transfected 293T cell line by FUT1 polyclonal antibody. Lane 1: FUT1 transfected lysate (41.3kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Fucosyltransferase 1 Polyclonal Antibody | anti-FUT1 antibody

Fucosyltransferase 1 (FUT1, 2-alpha-L-fucosyltransferase 1, Alpha(1,2)FT 1, Blood Group H alpha 2-fucosyltransferase, Galactoside 2-alpha-L-fucosyltransferase 1, GDP-L-fucose:beta-D-galactoside, H, HH, HSC) (PE)

Gene Names
FUT1; H; HH; HSC
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Fucosyltransferase 1; Polyclonal Antibody; Fucosyltransferase 1 (FUT1; 2-alpha-L-fucosyltransferase 1; Alpha(1; 2)FT 1; Blood Group H alpha 2-fucosyltransferase; Galactoside 2-alpha-L-fucosyltransferase 1; GDP-L-fucose:beta-D-galactoside; H; HH; HSC) (PE); anti-FUT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FUT1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-FUT1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FUT1, aa1-365 (NP_000139.1).
Immunogen Sequence
MWLRSHRQLCLAFLLVCVLSVIFFLHIHQDSFPHGLGLSILCPDRRLVTPPVAIFCLPGTAMGPNASSSCPQHPASLSGTWTVYPNGRFGNQMGQYATLLALAQLNGRRAFILPAMHAALAPVFRITLPVLAPEVDSRTPWRELQLHDWMSEEYADLRDPFLKLSGFPCSWTFFHHLREQIRREFTLHDHLREEAQSVLGQLRLGRTGDRPRTFVGVHVRRGDYLQVMPQRWKGVVGDSAYLRQAMDWFRARHEAPVFVVTSNGMEWCKENIDTSQGDVTFAGDGQEATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFKPEAAFLPEWVGINADLSPLWTLAKP
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FUT1 expression in transfected 293T cell line by FUT1 polyclonal antibody. Lane 1: FUT1 transfected lysate (41.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FUT1 expression in transfected 293T cell line by FUT1 polyclonal antibody. Lane 1: FUT1 transfected lysate (41.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FUT1 antibody
FUT1 is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway.
Product Categories/Family for anti-FUT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,251 Da
NCBI Official Full Name
galactoside 2-alpha-L-fucosyltransferase 1
NCBI Official Synonym Full Names
fucosyltransferase 1 (H blood group)
NCBI Official Symbol
FUT1
NCBI Official Synonym Symbols
H; HH; HSC
NCBI Protein Information
galactoside 2-alpha-L-fucosyltransferase 1
UniProt Protein Name
Galactoside 2-alpha-L-fucosyltransferase 1
UniProt Gene Name
FUT1
UniProt Synonym Gene Names
H; HSC
UniProt Entry Name
FUT1_HUMAN

NCBI Description

The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of a precursor of the H antigen, which is required for the final step in the soluble A and B antigen synthesis pathway. This gene is one of two encoding the galactoside 2-L-fucosyltransferase enzyme. Mutations in this gene are a cause of the H-Bombay blood group. [provided by RefSeq, Jul 2008]

Uniprot Description

FUT1: Creates a soluble precursor oligosaccharide FuC-alpha ((1,2)Galbeta-) called the H antigen which is an essential substrate for the final step in the soluble A and B antigen synthesis pathway. H and Se enzymes fucosylate the same acceptor substrates but exhibit different Km values. Belongs to the glycosyltransferase 11 family.

Protein type: Glycan Metabolism - glycosphingolipid biosynthesis - lacto and neolacto series; Membrane protein, integral; Transferase; EC 2.4.1.69; Glycan Metabolism - glycosphingolipid biosynthesis - globo series

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: Golgi apparatus; integral to plasma membrane; membrane

Molecular Function: fucosyltransferase activity; galactoside 2-alpha-L-fucosyltransferase activity

Biological Process: carbohydrate metabolic process; L-fucose catabolic process; protein amino acid glycosylation

Research Articles on FUT1

Similar Products

Product Notes

The FUT1 fut1 (Catalog #AAA6379009) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Fucosyltransferase 1 (FUT1, 2-alpha-L-fucosyltransferase 1, Alpha(1,2)FT 1, Blood Group H alpha 2-fucosyltransferase, Galactoside 2-alpha-L-fucosyltransferase 1, GDP-L-fucose:beta-D-galactoside, H, HH, HSC) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Fucosyltransferase 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FUT1 fut1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Fucosyltransferase 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.