Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FPR2 expression in transfected 293T cell line by FPR2 polyclonal antibody. Lane 1: FPRL1 transfected lysate (39kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human FPR2 Polyclonal Antibody | anti-FPR2 antibody

FPR2 (N-formyl Peptide Receptor 2, FMLP-related Receptor I, FMLP-R-I, Formyl Peptide Receptor-like 1, HM63, Lipoxin A4 Receptor, LXA4 Receptor, RFP, FPRH1, FPRL1, LXA4R) APC

Gene Names
FPR2; ALXR; HM63; FMLPX; FPR2A; FPRH1; FPRH2; FPRL1; LXA4R; FMLP-R-II
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FPR2; Polyclonal Antibody; FPR2 (N-formyl Peptide Receptor 2; FMLP-related Receptor I; FMLP-R-I; Formyl Peptide Receptor-like 1; HM63; Lipoxin A4 Receptor; LXA4 Receptor; RFP; FPRH1; FPRL1; LXA4R) APC; anti-FPR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FPR2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-FPR2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human FPR2, aa1-351 (NP_001005738.1).
Immunogen Sequence
METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FPR2 expression in transfected 293T cell line by FPR2 polyclonal antibody. Lane 1: FPRL1 transfected lysate (39kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FPR2 expression in transfected 293T cell line by FPR2 polyclonal antibody. Lane 1: FPRL1 transfected lysate (39kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FPR2 antibody
Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in an anti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4).
Product Categories/Family for anti-FPR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,964 Da
NCBI Official Full Name
N-formyl peptide receptor 2
NCBI Official Synonym Full Names
formyl peptide receptor 2
NCBI Official Symbol
FPR2
NCBI Official Synonym Symbols
ALXR; HM63; FMLPX; FPR2A; FPRH1; FPRH2; FPRL1; LXA4R; FMLP-R-II
NCBI Protein Information
N-formyl peptide receptor 2; RFP; FMLP-R-I; LXA4 receptor; FMLP-related receptor I; formyl peptide receptor-like 1; lipoxin A4 receptor (formyl peptide receptor related)
UniProt Protein Name
N-formyl peptide receptor 2
Protein Family
UniProt Gene Name
FPR2
UniProt Synonym Gene Names
FPRH1; FPRL1; LXA4R; FMLP-R-I; LXA4 receptor
UniProt Entry Name
FPR2_HUMAN

Uniprot Description

FPR2: Low affinity receptor for N-formyl-methionyl peptides, which are powerful neutrophils chemotactic factors. Binding of FMLP to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. The activation of LXA4R could result in an anti-inflammatory outcome counteracting the actions of proinflammatory signals such as LTB4 (leukotriene B4). Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Receptor, GPCR; Membrane protein, multi-pass; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 19q13.3-q13.4

Cellular Component: plasma membrane; integral to membrane

Molecular Function: G-protein coupled receptor activity; N-formyl peptide receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; chemotaxis; cell motility; inflammatory response; cell adhesion

Similar Products

Product Notes

The FPR2 fpr2 (Catalog #AAA6378912) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FPR2 (N-formyl Peptide Receptor 2, FMLP-related Receptor I, FMLP-R-I, Formyl Peptide Receptor-like 1, HM63, Lipoxin A4 Receptor, LXA4 Receptor, RFP, FPRH1, FPRL1, LXA4R) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FPR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FPR2 fpr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FPR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.