Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-FOXL2 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Rabbit FOXL2 Polyclonal Antibody | anti-FOXL2 antibody

FOXL2 antibody - N-terminal region

Gene Names
FOXL2; BPES; PFRK; POF3; BPES1; PINTO
Reactivity
Cow, Dog, Goat, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
FOXL2; Polyclonal Antibody; FOXL2 antibody - N-terminal region; anti-FOXL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MMASYPEPEDAAGALLAPETGRTVKEPEGPPPSPGKGGGGGGGTAPEKPD
Sequence Length
376
Applicable Applications for anti-FOXL2 antibody
Western Blot (WB)
Homology
Cow: 84%; Dog: 100%; Goat: 92%; Human: 100%; Mouse: 84%; Pig: 100%; Rabbit: 92%; Rat: 84%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-FOXL2 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-FOXL2 Antibody Titration: 1.25ug/mlELISA Titer: 1:312500Positive Control: Jurkat cell lysate)
Related Product Information for anti-FOXL2 antibody
This is a rabbit polyclonal antibody against FOXL2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: FOXL2 is a member of the forkhead family. The forkhead domain is a monomeric DNA binding motif that defines a rapidly growing family of eukaryotic transcriptional regulators. Genetic and biochemical data suggest a central role in embryonic development for forkhead proteins.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
668
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
forkhead box protein L2
NCBI Official Synonym Full Names
forkhead box L2
NCBI Official Symbol
FOXL2
NCBI Official Synonym Symbols
BPES; PFRK; POF3; BPES1; PINTO
NCBI Protein Information
forkhead box protein L2
UniProt Protein Name
Forkhead box protein L2
Protein Family
UniProt Gene Name
FOXL2
UniProt Entry Name
FOXL2_HUMAN

NCBI Description

This gene encodes a forkhead transcription factor. The protein contains a fork-head DNA-binding domain and may play a role in ovarian development and function. Expansion of a polyalanine repeat region and other mutations in this gene are a cause of blepharophimosis syndrome and premature ovarian failure 3. [provided by RefSeq, Jul 2016]

Uniprot Description

FOXL2: Transcriptional regulator. Critical factor essential for ovary differentiation and maintenance, and repression of the genetic program for somatic testis determination. Prevents trans- differentiation of ovary to testis through transcriptional repression of the Sertoli cell-promoting gene SOX9. Has apoptotic activity in ovarian cells. Suppresses ESR1-mediated transcription of PTGS2/COX2 stimulated by tamoxifen. Is a regulator of CYP19 expression. Participates in SMAD3-dependent transcription of FST via the intronic SMAD-binding element. Is a transcriptional repressor of STAR. Activates SIRT1 transcription under cellular stress conditions. Activates transcription of OSR2. Defects in FOXL2 are a cause of blepharophimosis, ptosis, and epicanthus inversus syndrome (BPES); also known as blepharophimosis syndrome. It is an autosomal dominant disorder characterized by eyelid dysplasia, small palpebral fissures, drooping eyelids and a skin fold running inward and upward from the lower lid. In type I BPSE (BPES1) eyelid abnormalities are associated with female infertility. Affected females show an ovarian deficit due to primary amenorrhea or to premature ovarian failure (POF). In type II BPSE (BPES2) affected individuals show only the eyelid defects. There is a mutational hotspot in the region coding for the poly-Ala domain, since 30% of all mutations in the ORF lead to poly-Ala expansions, resulting mainly in BPES type II. Defects in FOXL2 are a cause of premature ovarian failure type 3 (POF3). An ovarian disorder defined as the cessation of ovarian function under the age of 40 years. It is characterized by oligomenorrhea or amenorrhea, in the presence of elevated levels of serum gonadotropins and low estradiol.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 3q23

Cellular Component: nucleus

Molecular Function: protein binding; DNA binding; ubiquitin conjugating enzyme binding; sequence-specific DNA binding; caspase regulator activity; estrogen receptor binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; embryonic eye morphogenesis; positive regulation of apoptosis; positive regulation of transcription, DNA-dependent; female somatic sex determination; positive regulation of caspase activity; negative regulation of transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; ovarian follicle development; positive regulation of transcription from RNA polymerase II promoter; DNA fragmentation during apoptosis; menstruation; extraocular skeletal muscle development; cell differentiation; negative regulation of transcription, DNA-dependent; granulosa cell differentiation

Disease: Blepharophimosis, Ptosis, And Epicanthus Inversus; Premature Ovarian Failure 3

Research Articles on FOXL2

Similar Products

Product Notes

The FOXL2 foxl2 (Catalog #AAA3201471) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXL2 antibody - N-terminal region reacts with Cow, Dog, Goat, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FOXL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FOXL2 foxl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MMASYPEPED AAGALLAPET GRTVKEPEGP PPSPGKGGGG GGGTAPEKPD. It is sometimes possible for the material contained within the vial of "FOXL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.