Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FOXD4L1Sample Tissue: Human Fetal BrainAntibody Dilution: 1ug/ml)

Rabbit FOXD4L1 Polyclonal Antibody | anti-FOXD4L1 antibody

FOXD4L1 Antibody - N-terminal region

Gene Names
FOXD4L1; FOXD5; bA395L14.1
Reactivity
Cow, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FOXD4L1; Polyclonal Antibody; FOXD4L1 Antibody - N-terminal region; anti-FOXD4L1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPG
Sequence Length
408
Applicable Applications for anti-FOXD4L1 antibody
Western Blot (WB)
Homology
Cow: 79%; Human: 100%; Pig: 86%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human FOXD4L1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FOXD4L1Sample Tissue: Human Fetal BrainAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FOXD4L1Sample Tissue: Human Fetal BrainAntibody Dilution: 1ug/ml)
Related Product Information for anti-FOXD4L1 antibody
This is a rabbit polyclonal antibody against FOXD4L1. It was validated on Western Blot

Target Description: This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer. This gene lies in a region of chromosome 2 that surrounds the site where two ancestral chromosomes fused to form human chromosome 2. This region is duplicated elsewhere in the human genome, primarily in subtelomeric and pericentromeric locations, thus mutiple copies of this gene have been found.
Product Categories/Family for anti-FOXD4L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
forkhead box protein D4-like 1
NCBI Official Synonym Full Names
forkhead box D4 like 1
NCBI Official Symbol
FOXD4L1
NCBI Official Synonym Symbols
FOXD5; bA395L14.1
NCBI Protein Information
forkhead box protein D4-like 1
UniProt Protein Name
Forkhead box protein D4-like 1
Protein Family
UniProt Gene Name
FOXD4L1
UniProt Synonym Gene Names
FOXD4-like 1
UniProt Entry Name
FX4L1_HUMAN

NCBI Description

This gene is a member of the forkhead/winged-helix (FOX) family of transcription factors with highly conserved FOX DNA-binding domains. Members of the FOX family of transcription factors are regulators of embryogenesis and may play a role in human cancer. This gene lies in a region of chromosome 2 that surrounds the site where two ancestral chromosomes fused to form human chromosome 2. This region is duplicated elsewhere in the human genome, primarily in subtelomeric and pericentromeric locations, thus mutiple copies of this gene have been found. [provided by RefSeq, Jul 2008]

Uniprot Description

FOXD4L1:

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 2q13

Cellular Component: nucleus

Molecular Function: sequence-specific DNA binding

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter

Similar Products

Product Notes

The FOXD4L1 foxd4l1 (Catalog #AAA3219089) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FOXD4L1 Antibody - N-terminal region reacts with Cow, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's FOXD4L1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FOXD4L1 foxd4l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PRSTPQRSLR DSDGEDGKID VLGEEEDEDE VEDEEEEASQ KFLEQSLQPG. It is sometimes possible for the material contained within the vial of "FOXD4L1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.