Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- FOXA3 Picoband antibody, MBS178032, Western blottingAll lanes: Anti FOXA3 (MBS178032) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Pancreas Tissue Lysate at 50ugLane 3: Mouse Liver Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 37KDObserved bind size: 37KD)

FOXA3 Polyclonal Antibody | anti-FOXA3 antibody

Anti-FOXA3 Antibody

Gene Names
FOXA3; FKHH3; HNF3G; TCF3G
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
FOXA3; Polyclonal Antibody; Anti-FOXA3 Antibody; Hepatocyte nuclear factor 3-gamma; FKHH3; Fork head-related protein FKH H3; forkhead box A3; Forkhead box protein A3; Foxa3; FOXA3_HUMAN; hepatic nuclear factor-3-beta; hepatocyte nuclear factor 3; hepatocyte nuclear factor 3 gamma; HNF-3-gamma; HNF-3G; HNF3B; HNF3G; TCF-3G; TCF3G; Transcription factor 3G; anti-FOXA3 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
350
Applicable Applications for anti-FOXA3 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human FOXA3 (291-324aa ELKLDAPYNFNHPFSINNLMSEQTPAPPKLDVGF), different from the related mouse and rat sequences by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- FOXA3 Picoband antibody, MBS178032, Western blottingAll lanes: Anti FOXA3 (MBS178032) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Pancreas Tissue Lysate at 50ugLane 3: Mouse Liver Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 37KDObserved bind size: 37KD)

Western Blot (WB) (Anti- FOXA3 Picoband antibody, MBS178032, Western blottingAll lanes: Anti FOXA3 (MBS178032) at 0.5ug/mlLane 1: Rat Liver Tissue Lysate at 50ugLane 2: Rat Pancreas Tissue Lysate at 50ugLane 3: Mouse Liver Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 37KDObserved bind size: 37KD)
Related Product Information for anti-FOXA3 antibody
Description: Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 3-gamma(FOXA3) detection. Tested with WB in Human;Mouse;Rat.

Background: Hepatocyte nuclear factor 3-gamma (HNF-3G), also known as forkhead box protein A3 (FOXA3) or transcription factor 3G (TCF-3G), is a protein that in humans is encoded by the FOXA3 gene. This gene is mapped to 19q13.32. HNF-3G is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved.
References
1. "Entrez Gene: forkhead box A3". 2. Mincheva A, Lichter P, Schütz G, Kaestner KH (February 1997). "Assignment of the human genes for hepatocyte nuclear factor 3-alpha, -beta, and -gamma (HNF3A, HNF3B, HNF3G) to 14q12-q13, 20p11, and 19q13.2-q13.4".Genomics 39 (3): 417-9. 3. Navas MA, Vaisse C, Boger S; et al. (2000). "The human HNF-3 genes: cloning, partial sequence and mutation screening in patients with impaired glucose homeostasis.". Hum. Hered. 50 (6): 370-81.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,140 Da
NCBI Official Full Name
hepatocyte nuclear factor 3-gamma
NCBI Official Synonym Full Names
forkhead box A3
NCBI Official Symbol
FOXA3
NCBI Official Synonym Symbols
FKHH3; HNF3G; TCF3G
NCBI Protein Information
hepatocyte nuclear factor 3-gamma
UniProt Protein Name
Hepatocyte nuclear factor 3-gamma
Protein Family
UniProt Gene Name
FOXA3
UniProt Synonym Gene Names
HNF3G; TCF3G; HNF-3-gamma; HNF-3G; TCF-3G
UniProt Entry Name
FOXA3_HUMAN

NCBI Description

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. The crystal structure of a similar protein in rat has been resolved. [provided by RefSeq, Jul 2008]

Uniprot Description

FOXA3: Transcription factor that is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis; binds to and activates transcription from the G6PC promoter. Binds to the CYP3A4 promoter and activates its transcription in cooperation with CEBPA. Binds to the CYP3A7 promoter together with members of the CTF/NF-I family. Involved in regulation of neuronal-specific transcription. May be involved in regulation of spermatogenesis.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 19q13.32

Cellular Component: nucleus

Molecular Function: protein domain specific binding; sequence-specific DNA binding; transcription factor activity; transcription factor binding

Biological Process: cell differentiation; cell glucose homeostasis; cellular response to starvation; chromatin modification; multicellular organismal development; positive regulation of transcription from RNA polymerase II promoter; spermatogenesis; transcription, DNA-dependent

Research Articles on FOXA3

Similar Products

Product Notes

The FOXA3 foxa3 (Catalog #AAA178032) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-FOXA3 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FOXA3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the FOXA3 foxa3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXA3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.