Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of Rat brain, using Folate Binding Protein(FBP) / FOLR1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Rabbit Folate Binding Protein (FBP)/FOLR1 Polyclonal Antibody | anti-FBP antibody

Folate Binding Protei n(FBP)/FOLR1 Rabbit pAb

Gene Names
FOLR1; FBP; FOLR
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
Folate Binding Protein (FBP)/FOLR1; Polyclonal Antibody; Folate Binding Protei n(FBP)/FOLR1 Rabbit pAb; FOLR1; FBP; FOLR; anti-FBP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMA
Applicable Applications for anti-FBP antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 25-93 of human Folate Binding Protein(FBP)/FOLR1 (NP_000793.1).
Cellular Location
Apical cell membrane, Cell membrane, Cytoplasmic vesicle, Endosome, GPI-anchor, Lipid-anchor, Secreted, clathrin-coated vesicle
Positive Samples
Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of Rat brain, using Folate Binding Protein(FBP) / FOLR1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Western Blot (WB) (Western blot analysis of extracts of Rat brain, using Folate Binding Protein(FBP) / FOLR1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded rat testis using Folate Binding Protein(FBP) / FOLR1 Rabbit pAb at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded rat testis using Folate Binding Protein(FBP) / FOLR1 Rabbit pAb at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC)

(Immunohistochemistry of paraffin-embedded human colon using Folate Binding Protein(FBP) / FOLR1 Rabbit pAb at dilution of 1:100 (40x lens).)

Immunohistochemistry (IHC) (Immunohistochemistry of paraffin-embedded human colon using Folate Binding Protein(FBP) / FOLR1 Rabbit pAb at dilution of 1:100 (40x lens).)

Immunofluorescence (IF)

(Immunofluorescence analysis of NIH-3T3 cells using Folate Binding Protein(FBP) / FOLR1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of NIH-3T3 cells using Folate Binding Protein(FBP) / FOLR1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Immunofluorescence (IF)

(Immunofluorescence analysis of U-2 OS cells using Folate Binding Protein(FBP) / FOLR1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of U-2 OS cells using Folate Binding Protein(FBP) / FOLR1 Rabbit pAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
Related Product Information for anti-FBP antibody
Background: The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. Mutations in this gene have been associated with neurodegeneration due to cerebral folate transport deficiency. Due to the presence of two promoters, multiple transcription start sites, and alternative splicing, multiple transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-FBP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,819 Da
NCBI Official Full Name
folate receptor alpha
NCBI Official Synonym Full Names
folate receptor 1 (adult)
NCBI Official Symbol
FOLR1
NCBI Official Synonym Symbols
FBP; FOLR
NCBI Protein Information
folate receptor alpha; FR-alpha; KB cells FBP; folate binding protein; folate receptor, adult; adult folate-binding protein; ovarian tumor-associated antigen MOv18
UniProt Protein Name
Folate receptor alpha
UniProt Gene Name
FOLR1
UniProt Synonym Gene Names
FOLR; FR-alpha; FBP
UniProt Entry Name
FOLR1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. Mutations in this gene have been associated with neurodegeneration due to cerebral folate transport deficiency. Due to the presence of two promoters, multiple transcription start sites, and alternative splicing, multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Oct 2009]

Uniprot Description

FOLR1: Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate to the interior of cells. Defects in FOLR1 are the cause of neurodegeneration due to cerebral folate transport deficiency (NCFTD). NCFTD is an autosomal recessive disorder resulting from brain- specific folate deficiency early in life. Onset is apparent in late infancy with severe developmental regression, movement disturbances, epilepsy, and leukodystrophy. Recognition and diagnosis of this disorder is critical because folinic acid therapy can reverse the clinical symptoms and improve brain abnormalities and function. Belongs to the folate receptor family.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 11q13.3-q14.1

Cellular Component: anchored to external side of plasma membrane; cell surface; membrane; clathrin-coated vesicle; brush border membrane; integral to plasma membrane; apical plasma membrane; plasma membrane; endosome

Molecular Function: folic acid transporter activity; receptor activity; folic acid binding

Biological Process: receptor-mediated endocytosis; folic acid metabolic process; folic acid transport

Disease: Neurodegeneration Due To Cerebral Folate Transport Deficiency

Research Articles on FBP

Similar Products

Product Notes

The FBP folr1 (Catalog #AAA9142087) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Folate Binding Protei n(FBP)/FOLR1 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Folate Binding Protein (FBP)/FOLR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:200. Researchers should empirically determine the suitability of the FBP folr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RIAWARTELL NVCMNAKHHK EKPGPEDKLH EQCRPWRKNA CCSTNTSQEA HKDVSYLYRF NWNHCGEMA. It is sometimes possible for the material contained within the vial of "Folate Binding Protein (FBP)/FOLR1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.