Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Fmr1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Lung)

Rabbit Fmr1 Polyclonal Antibody | anti-FMR1 antibody

Fmr1 antibody - C-terminal region

Gene Names
Fmr1; FMRP
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Fmr1; Polyclonal Antibody; Fmr1 antibody - C-terminal region; anti-FMR1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QIGASSRPPPNRTDKEKGYVTDDGQGMGRGSRPYRNRGHGRRGPGYTSES
Sequence Length
593
Applicable Applications for anti-FMR1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Rat
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Fmr1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Lung)

Western Blot (WB) (WB Suggested Anti-Fmr1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Rat Lung)
Related Product Information for anti-FMR1 antibody
This is a rabbit polyclonal antibody against Fmr1. It was validated on Western Blot

Target Description: Fmr1 is a translation repressor. Fmr1 is a component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit mediates translation repression. RNA-binding protein that plays a role in intracellular RNA transport and in the regulation of translation of target mRNAs.Fmr1 is associated with polysomes. Fmr1 is involved in the transport of mRNA from the nucleus to the cytoplasm. Fmr1 binds strongly to poly(G), binds moderately to poly(U) but shows very little binding to poly(A) or poly(C).
Product Categories/Family for anti-FMR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67kDa
NCBI Official Full Name
synaptic functional regulator FMR1
NCBI Official Synonym Full Names
fragile X mental retardation 1
NCBI Official Symbol
Fmr1
NCBI Official Synonym Symbols
FMRP
NCBI Protein Information
synaptic functional regulator FMR1
UniProt Protein Name
Fragile X mental retardation protein 1 homolog
UniProt Gene Name
Fmr1
UniProt Synonym Gene Names
FMRP
UniProt Entry Name
FMR1_RAT

NCBI Description

may play a role in mRNA trafficking and localization [RGD, Feb 2006]

Uniprot Description

Function: Translation repressor. Component of the CYFIP1-EIF4E-FMR1 complex which binds to the mRNA cap and mediates translational repression. In the CYFIP1-EIF4E-FMR1 complex this subunit mediates translation repression. RNA-binding protein that plays a role in intracellular RNA transport and in the regulation of translation of target mRNAs. Associated with polysomes. Involved in the transport of mRNA from the nucleus to the cytoplasm. Binds strongly to poly(G), binds moderately to poly(U) but shows very little binding to poly(A) or poly(C)

By similarity.

Subunit structure: Homooligomer. Found in a RNP granule complex with IGF2BP1. Directly interacts with SMN and TDRD3. Interacts with the SMN core complex that contains SMN1, GEMIN2/SIP1, DDX20/GEMIN3, GEMIN4, GEMIN5, GEMIN6, GEMIN7, GEMIN8 and STRAP/UNRIP. Interacts with FXR1, FXR2, IGF2BP1, NUFIP1, NUFIP2, MCRS1 and RANBP9. Component of the CYFIP1-EIF4E-FMR1 complex which is composed of CYFIP, EIF4E and FMR1. Interacts with CYFIP1 and CYFIP2. The interaction with brain cytoplasmic RNA 1 (BC1) increases binding affinity for the CYFIP1-EIF4E complex in the brain

By similarity.

Subcellular location: Cytoplasm

By similarity. Nucleus › nucleolus

By similarity.

Domain: The tandem Tudor domains preferentially recognize trimethylated histone peptides

By similarity.

Post-translational modification: Phosphorylated on several serine residues

By similarity.

Miscellaneous: RNA-binding activity is inhibited by RANBP9

By similarity.

Sequence similarities: Belongs to the FMR1 family.Contains 2 Agenet-like domains.Contains 2 KH domains.

Sequence caution: The sequence AAB07073.1 differs from that shown. Reason: N-ter sequencing errors.

Research Articles on FMR1

Similar Products

Product Notes

The FMR1 fmr1 (Catalog #AAA3205185) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Fmr1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Fmr1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FMR1 fmr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QIGASSRPPP NRTDKEKGYV TDDGQGMGRG SRPYRNRGHG RRGPGYTSES. It is sometimes possible for the material contained within the vial of "Fmr1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.