Western Blot (WB)
(Anti- FMO2 Picoband antibody, MBS177952, Western blottingAll lanes: Anti FMO2 (MBS177952) at 0.5ug/mlLane 1: A549 Whole Cell Lysate at 40ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: MCF-7 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 54KDObserved bind size: 54KD)
anti-Human FMO2 Polyclonal Antibody | anti-FMO2 antibody
Anti-FMO2 Antibody
Gene Names
FMO2; FMO1B1
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
FMO2; Polyclonal Antibody; Anti-FMO2 Antibody; Dimethylaniline monooxygenase [N-oxide-forming] 2; 2310008D08Rik; 2310042I22Rik; AW107733; Dimethylaniline monooxygenase [N oxide forming] 2; Dimethylaniline oxidase 2; Flavin containing monooxygenase 2 (non functional); Flavin containing monooxygenase 2; FLJ40826; FMO 1B1; FMO 2; FMO; FMO pulmonary; FMO1B1; FMO2_HUMAN; MGC28212; OTTMUSP00000028686; OTTMUSP00000028687; Pulmonary flavin containing monooxygenase 2; Pulmonary flavin-containing monooxygenase 2; flavin containing monooxygenase 2; anti-FMO2 antibody
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
535
Applicable Applications for anti-FMO2 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human FMO2 (78-115aa FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK), different from the related mouse and rat sequences by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Anti- FMO2 Picoband antibody, MBS177952, Western blottingAll lanes: Anti FMO2 (MBS177952) at 0.5ug/mlLane 1: A549 Whole Cell Lysate at 40ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: MCF-7 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 54KDObserved bind size: 54KD)
Western Blot (WB)
(Anti- FMO2 Picoband antibody, MBS177952, Western blottingAll lanes: Anti FMO2 (MBS177952) at 0.5ug/mlLane 1: A549 Whole Cell Lysate at 40ugLane 2: HELA Whole Cell Lysate at 40ugLane 3: MCF-7 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 54KDObserved bind size: 54KD)
Related Product Information for anti-FMO2 antibody
Description: Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 2(FMO2) detection. Tested with WB in Human.
Background: Dimethylaniline monooxygenase [N-oxide-forming] 2 is an enzyme that in humans is encoded by the FMO2 gene. This gene encodes a flavin-containing monooxygenase family member. It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants.
Background: Dimethylaniline monooxygenase [N-oxide-forming] 2 is an enzyme that in humans is encoded by the FMO2 gene. This gene encodes a flavin-containing monooxygenase family member. It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants.
References
1. "Entrez Gene: FMO2 flavin containing monooxygenase 2 (non-functional)". 2. Dolphin CT, Shephard EA, Povey S, Smith RL, Phillips IR (Nov 1992). "Cloning, primary sequence and chromosomal localization of human FMO2, a new member of the flavin-containing mono-oxygenase family".Biochem J. 287. (Pt 1): 261-7. 3. Dolphin CT, Beckett DJ, Janmohamed A, Cullingford TE, Smith RL, Shephard EA, Phillips IR (Dec 1998). "The flavin-containing monooxygenase 2 gene (FMO2) of humans, but not of other primates, encodes a truncated, nonfunctional protein". J Biol Chem 273 (46): 30599-607.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
53,644 Da
NCBI Official Full Name
dimethylaniline monooxygenase
NCBI Official Synonym Full Names
flavin containing monooxygenase 2
NCBI Official Symbol
FMO2
NCBI Official Synonym Symbols
FMO1B1
NCBI Protein Information
dimethylaniline monooxygenase [N-oxide-forming] 2
UniProt Protein Name
Dimethylaniline monooxygenase [N-oxide-forming] 2
Protein Family
UniProt Gene Name
FMO2
UniProt Synonym Gene Names
FMO 2
UniProt Entry Name
FMO2_HUMAN
NCBI Description
This gene encodes a flavin-containing monooxygenase family member. It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2014]
Uniprot Description
Catalyzes the N-oxidation of certain primary alkylamines to their oximes via an N-hydroxylamine intermediate. Inactive toward certain tertiary amines, such as imipramine or chloropromazine. Can catalyze the S-oxidation of methimazole. The truncated form is catalytically inactive.
Research Articles on FMO2
Similar Products
Product Notes
The FMO2 fmo2 (Catalog #AAA177952) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-FMO2 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FMO2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the FMO2 fmo2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FMO2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
