Western Blot (WB)
(WB Suggested Anti-FLVCR2 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)
Rabbit FLVCR2 Polyclonal Antibody | anti-FLVCR2 antibody
FLVCR2 Antibody - C-terminal region
Gene Names
FLVCR2; CCT; EPV; PVHH; MFSD7C; SLC49A2; C14orf58; FLVCRL14q
Reactivity
Dog, Horse, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FLVCR2; Polyclonal Antibody; FLVCR2 Antibody - C-terminal region; anti-FLVCR2 antibody
Host
Rabbit
Reactivity
Dog, Horse, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CVFLTLGAALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSE
Sequence Length
321
Applicable Applications for anti-FLVCR2 antibody
Western Blot (WB)
Homology
Dog: 93%; Horse: 86%; Human: 100%; Pig: 93%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human FLVCR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-FLVCR2 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-FLVCR2 AntibodyTitration: 1.0 ug/mlPositive Control: HCT15 Whole Cell)
Related Product Information for anti-FLVCR2 antibody
This is a rabbit polyclonal antibody against FLVCR2. It was validated on Western Blot
Target Description: This gene encodes a member of the major facilitator superfamily. The encoded transmembrane protein is a calcium transporter. Unlike the related protein feline leukemia virus subgroup C receptor 1, the protein encoded by this locus does not bind to feline leukemia virus subgroup C envelope protein. The encoded protein may play a role in development of brain vascular endothelial cells, as mutations at this locus have been associated with proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome. Alternatively spliced transcript variants have been described.
Target Description: This gene encodes a member of the major facilitator superfamily. The encoded transmembrane protein is a calcium transporter. Unlike the related protein feline leukemia virus subgroup C receptor 1, the protein encoded by this locus does not bind to feline leukemia virus subgroup C envelope protein. The encoded protein may play a role in development of brain vascular endothelial cells, as mutations at this locus have been associated with proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-FLVCR2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
feline leukemia virus subgroup C receptor-related protein 2 isoform 2
NCBI Official Synonym Full Names
feline leukemia virus subgroup C cellular receptor family member 2
NCBI Official Symbol
FLVCR2
NCBI Official Synonym Symbols
CCT; EPV; PVHH; MFSD7C; SLC49A2; C14orf58; FLVCRL14q
NCBI Protein Information
feline leukemia virus subgroup C receptor-related protein 2
UniProt Protein Name
Feline leukemia virus subgroup C receptor-related protein 2
Protein Family
UniProt Gene Name
FLVCR2
UniProt Synonym Gene Names
C14orf58; CCT
UniProt Entry Name
FLVC2_HUMAN
NCBI Description
This gene encodes a member of the major facilitator superfamily. The encoded transmembrane protein is a calcium transporter. Unlike the related protein feline leukemia virus subgroup C receptor 1, the protein encoded by this locus does not bind to feline leukemia virus subgroup C envelope protein. The encoded protein may play a role in development of brain vascular endothelial cells, as mutations at this locus have been associated with proliferative vasculopathy and hydranencephaly-hydrocephaly syndrome. Alternatively spliced transcript variants have been described.[provided by RefSeq, Aug 2010]
Research Articles on FLVCR2
Similar Products
Product Notes
The FLVCR2 flvcr2 (Catalog #AAA3217073) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FLVCR2 Antibody - C-terminal region reacts with Dog, Horse, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's FLVCR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FLVCR2 flvcr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CVFLTLGAAL TAFIKADLRR QKANKETLEN KLQEEEEESN TSKVPTAVSE. It is sometimes possible for the material contained within the vial of "FLVCR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
