Western Blot (WB)
(WB Suggested Anti-FLCN AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Rabbit FLCN Polyclonal Antibody | anti-FLCN antibody
FLCN antibody - N-terminal region
Gene Names
FLCN; BHD; FLCL
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FLCN; Polyclonal Antibody; FLCN antibody - N-terminal region; anti-FLCN antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEGGIQMNSRMRAHSPAEGASVESSSPGPKKSDMCEGCRSLAAGHPGYIS
Sequence Length
579
Applicable Applications for anti-FLCN antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-FLCN AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Western Blot (WB)
(WB Suggested Anti-FLCN AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Heart)
Related Product Information for anti-FLCN antibody
This is a rabbit polyclonal antibody against FLCN. It was validated on Western Blot
Target Description: This gene is located within the Smith-Magenis syndrome region on chromosome 17. Mutations in this gene are associated with Birt-Hogg-Dube syndrome, which is characterized by fibrofolliculomas, renal tumors, lung cysts, and pneumothorax.
Target Description: This gene is located within the Smith-Magenis syndrome region on chromosome 17. Mutations in this gene are associated with Birt-Hogg-Dube syndrome, which is characterized by fibrofolliculomas, renal tumors, lung cysts, and pneumothorax.
Product Categories/Family for anti-FLCN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
folliculin isoform 1
NCBI Official Synonym Full Names
folliculin
NCBI Official Symbol
FLCN
NCBI Official Synonym Symbols
BHD; FLCL
NCBI Protein Information
folliculin
UniProt Protein Name
Folliculin
Protein Family
UniProt Gene Name
FLCN
UniProt Synonym Gene Names
BHD
NCBI Description
This gene is located within the Smith-Magenis syndrome region on chromosome 17. Mutations in this gene are associated with Birt-Hogg-Dube syndrome, which is characterized by fibrofolliculomas, renal tumors, lung cysts, and pneumothorax. Alternative splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Uniprot Description
May be a tumor suppressor. May be involved in energy and/or nutrient sensing through the AMPK and mTOR signaling pathways. May regulate phosphorylation of RPS6KB1.
Research Articles on FLCN
1. FLCN functions as a Rab7A GTPase-activating protein.Negative regulation of EGFR signalling by FLCN.
Similar Products
Product Notes
The FLCN flcn (Catalog #AAA3215257) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FLCN antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FLCN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FLCN flcn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEGGIQMNSR MRAHSPAEGA SVESSSPGPK KSDMCEGCRS LAAGHPGYIS. It is sometimes possible for the material contained within the vial of "FLCN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
