Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Heart )

Rabbit FHL2 Polyclonal Antibody | anti-FHL2 antibody

FHL2 antibody - C-terminal region

Gene Names
FHL2; DRAL; AAG11; FHL-2; SLIM3; SLIM-3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
FHL2; Polyclonal Antibody; FHL2 antibody - C-terminal region; anti-FHL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDC
Sequence Length
279
Applicable Applications for anti-FHL2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 87%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human FHL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Heart )

Immunohistochemistry (IHC) (Human Heart )

Western Blot (WB)

(WB Suggested Anti-FHL2 Antibody Titration: 0.6ug/mlELISA Titer: 1:312500Positive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-FHL2 Antibody Titration: 0.6ug/mlELISA Titer: 1:312500Positive Control: Human heart)
Related Product Information for anti-FHL2 antibody
This is a rabbit polyclonal antibody against FHL2. It was validated on Western Blot and immunohistochemistry

Target Description: FHL2 is a member of LIM proteins that contain a highly conserved double zinc finger motif called the LIM domain.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
four and a half LIM domains protein 2 isoform a
NCBI Official Synonym Full Names
four and a half LIM domains 2
NCBI Official Symbol
FHL2
NCBI Official Synonym Symbols
DRAL; AAG11; FHL-2; SLIM3; SLIM-3
NCBI Protein Information
four and a half LIM domains protein 2
UniProt Protein Name
Four and a half LIM domains protein 2
UniProt Gene Name
FHL2
UniProt Synonym Gene Names
DRAL; SLIM3; FHL-2; SLIM-3
UniProt Entry Name
FHL2_HUMAN

NCBI Description

This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. This protein is thought to have a role in the assembly of extracellular membranes. Also, this gene is down-regulated during transformation of normal myoblasts to rhabdomyosarcoma cells and the encoded protein may function as a link between presenilin-2 and an intracellular signaling pathway. Multiple alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq, Jan 2016]

Uniprot Description

FHL2: May function as a molecular transmitter linking various signaling pathways to transcriptional regulation. Negatively regulates the transcriptional repressor E4F1 and may function in cell growth. Inhibits the transcriptional activity of FOXO1 and its apoptotic function by enhancing the interaction of FOXO1 with SIRT1 and FOXO1 deacetylation.

Protein type: Motility/polarity/chemotaxis; Nuclear receptor co-regulator; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 2q12.2

Cellular Component: nucleoplasm; focal adhesion; M band; nucleus; Z disc; actin cytoskeleton

Molecular Function: identical protein binding; protein binding; androgen receptor binding; zinc ion binding; transcription coactivator activity; transcription factor binding

Biological Process: osteoblast differentiation; atrial cardiac muscle cell development; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; ventricular cardiac muscle cell development; androgen receptor signaling pathway; response to hormone stimulus; cellular lipid metabolic process; negative regulation of transcription from RNA polymerase II promoter; negative regulation of apoptosis

Research Articles on FHL2

Similar Products

Product Notes

The FHL2 fhl2 (Catalog #AAA3202102) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FHL2 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's FHL2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the FHL2 fhl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RFTARDDFAY CLNCFCDLYA KKCAGCTNPI SGLGGTKYIS FEERQWHNDC. It is sometimes possible for the material contained within the vial of "FHL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.